SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428314275|ref|YP_007125252.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428314275|ref|YP_007125252.1|
Domain Number 1 Region: 230-395
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 9.56e-40
Family Histidine kinase 0.0016
Further Details:      
 
Domain Number 2 Region: 10-102
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.31e-30
Family KaiB-like 0.00091
Further Details:      
 
Domain Number 3 Region: 151-240
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.0000000000145
Family Homodimeric domain of signal transducing histidine kinase 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428314275|ref|YP_007125252.1|
Sequence length 397
Comment histidine kinase,KaiB domain-containing protein,histidine kinase [Microcoleus sp. PCC 7113]
Sequence
MQAALEKYVDSEEPLQLLLFVDHQISSRKHIQRIQSYLKTLREDYPFELKVVDVGEQPYL
AEHYKLVATPALIKVHPKPRQTLAGSNLVAQLKNWWPRWQRSVEEHQSTMAQAVALPSSH
SSSNALQRVPAAPSSITSSIELIRLSDEIFRLKQEKEELLEQLRFKEHVISMLAHDLRSP
LTAASIAMETLELEHKPKEGCTTELTPALKARLLKQARSQFRSMERMITDLLESARGNSS
EFNPRPKKLQMGTLCEDVLAQMKEQFQLKSQQVETDIPQDLPCVYADEELVRQVLVNLLD
NANKYTPVDGKIQVSILHRTTQKIQVSVCDNGPGIPEENRDRIFEGHFRLKRDEAKEGYG
LGLSLCQKVIRAHYGRIWVECAPKGGGCFHFTLPIYL
Download sequence
Identical sequences K9WPW2
gi|428314275|ref|YP_007125252.1| WP_015185974.1.75295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]