SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428314450|ref|YP_007125426.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428314450|ref|YP_007125426.1|
Domain Number 1 Region: 560-710,813-1121
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.36e-55
Family Tandem AAA-ATPase domain 0.048
Further Details:      
 
Domain Number 2 Region: 5-264
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.37e-47
Family Protein kinases, catalytic subunit 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428314450|ref|YP_007125426.1|
Sequence length 1147
Comment protein kinase family protein [Microcoleus sp. PCC 7113]
Sequence
MPVRFINDRYALSPNPRAGGMADVYRARDYDLEERLVAVKVFKHGQIEADILAESFRRET
QALKELKHSGIVELLDSGKDESTGEYFVVLEWMEKDLEALLLESPPDGWDSFWKAVALPI
LEALAFSHNRNYIHRDIKPSNILVGSAGKVKLADFGISKLRSYLRPSVTLREFVSRPFTP
PEADDGSYSYTRDVFSFGVLVLKCLTQVKLVDYDSITQALDAFDAPTQILEVIERAVSLD
PAERYHNAEVLLAELNAIQGQRSQQWLTPKRPCYLQLTNNALTNLRTVLDAPQDEIQKII
LEDLNSGCGISPLKKSSAANRADESSEGHYSIFGFSYRYHVVVERDYLVIINAQDFSSAI
LEQNRERAWIPLYEFKFGKPLNRWEAEEVIRELQLAIEEHEANLRQTKAEEEKQRLFRIW
WDILKAKTDWERNREKPLQYTSFTRDGNRVIFQLAELPEDDLAGQPRHVTNIQGYSYLGG
DVEEVRGDELVLYVRSGEPERLPKSGELRFDSRAAEVALNRQKNALDAVRFDRAVRSDIR
QLLINSQEVRIPDVNKDIQFIQSLNPSQQQVVKAALTTEDFLIVQGPPGTGKTTFITEVV
LQTLKQNPEARILLSSQTHVALDNALERIKAQNSNLNLVRIGSHERVSENVHSLLLEDQM
EQWREAAIAKGQEFINDWSAQRGISQHDSEIATLFQEMKNLVTKIETLRGEINIWKQDLD
EILAINYDPENPDSLLEAKIPKNKLEECQSIESEISLLRKQLKEAREQQKEKAKRLKELT
GIATNKLLRLSTEEIEERINQLIDPNSPESKMLQRLLSIQAEWFEQFGRDERFNTPLIKR
SQVIAGTCIGIPRDIQDIEFDLCIIDEASKATATEVLVPIARSHRWILVGDPKQLPPFQD
EASRNADFLSKYDLEPDDIRETLFDYLLRTLPDGCCKMLTIQHRMVAPIGNLISECFYDG
KLKSARDDVDKNLLQVLPQPVTWLTTAKLPNCREQSANSSFNNPCEAKVIVELLNQLNRM
AVEAQKNYSIAVLTGYAAQLKLLNRRLASLLNNWQALKVECNTVDAFQGREADIAVYSVT
RSNKEGKVGFLRDSERMNVALSRGKVGLVIVGDHYFCRTLSQDNPLHRVLEYVEHHEKNC
VLKEASR
Download sequence
Identical sequences K9WNP0
gi|428314450|ref|YP_007125426.1|NC_019739 WP_015186147.1.75295 gi|428314450|ref|YP_007125426.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]