SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428314573|ref|YP_007151020.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428314573|ref|YP_007151020.1|
Domain Number 1 Region: 384-580
Classification Level Classification E-value
Superfamily TPR-like 4.17e-32
Family Tetratricopeptide repeat (TPR) 0.0095
Further Details:      
 
Domain Number 2 Region: 533-741
Classification Level Classification E-value
Superfamily TPR-like 1.23e-31
Family Tetratricopeptide repeat (TPR) 0.023
Further Details:      
 
Domain Number 3 Region: 11-189
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000000234
Family Extended AAA-ATPase domain 0.059
Further Details:      
 
Weak hits

Sequence:  gi|428314573|ref|YP_007151020.1|
Domain Number - Region: 302-413
Classification Level Classification E-value
Superfamily TPR-like 0.0825
Family Tetratricopeptide repeat (TPR) 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428314573|ref|YP_007151020.1|
Sequence length 863
Comment hypothetical protein Mic7113_6688 [Microcoleus sp. PCC 7113]
Sequence
MQSIPPHGREHLHFANQFWADVRQAPDFGIFAEQVLKALIGESLEEFSRLTTIEKINKLV
KHLNQQRCLLVIDNLEVLLDEQQWKDEGYQQFFSCWKEQGKNSTILLTSQEIPFSLQYES
WLMLNGLEPREGGNFLSSLGVQSNPSESNEQDELENFSQMLDGHPLALRLAASYLRLYCK
GKNILSQARQVGLVSFPSITKEASDEHRGEQTCLERLLQRHLERLTQNQYLSLIDLSVYR
LPFTEDAATAMIGVTDLIEVLRVLEAFVQRSLLTKSGNLYQLQPSIQKYIQGIAGNQTVA
HQKATHYYQKNIKSEPWSDLEDIRANLELFYHQCQFGSYLDAFTTTECVADFLDLKGYIL
QILNMYEHLQLNWQDDETNQKERNIIWNRLGYIRYYVGQASSAFQCYQQALNISFVIGEG
RCEAIALKGLGDLHNKPGTFEQAIDYYQQALEIARQINEKDIEVDSLSGLGSVYFQRSQY
EKSIDAYQKALQRHRTSGINTKRYRKTELSIILALGIAYKWQHDYGRAILVHREVLAIAQ
NIGDKEHEFDAYFGLGFIHFVQDKYSESIGYYREALKIAKDIGIQQKEAWILTDFGRICC
ACKQYPEALDYYKQALELNSTLGCQRGMAWTLMHQGSVYVGLEEYKEAIELYKQSINIYK
AISLFREMIQALCLMGVAYDFIGDFNQANEIYQEAITVAQATEYGHYEAVSYLLQTISLA
KPGDSLNALQSIQRAKILFQRMGIEDEIQHCDAVSQNYVFQVSSPSKLHFEIPDLPKLDL
PEREDSTITKQSEQSSDSLSDYQQSAISSDVSFSLTIVFYLFISLFILANFIQGHLILGS
IFLLVAVFFFFGQYLYSKRSQRK
Download sequence
Identical sequences K9WRS2
gi|428314573|ref|YP_007151020.1|NC_019761 gi|428314573|ref|YP_007151020.1| WP_015211567.1.75295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]