SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428314580|ref|YP_007151027.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428314580|ref|YP_007151027.1|
Domain Number 1 Region: 386-488
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 5.23e-16
Family Toll/Interleukin receptor TIR domain 0.0091
Further Details:      
 
Domain Number 2 Region: 2-133
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 0.00000314
Family Toll/Interleukin receptor TIR domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428314580|ref|YP_007151027.1|
Sequence length 510
Comment TIR domain-containing protein [Microcoleus sp. PCC 7113]
Sequence
MSDQLSSFNPKANLYISYPSQDQVLLDEFLKLLTALPWENITISSYHEGQIAELAQTEDI
ESRLSAADVVVMIVSSTYLDSVNRRRWELDEIAGKSIVIAINVSPVSLKASRLKGFCSSW
VDDSPVTSWSGQVEKLKIAAGAIYEAAAAIGSESNVSDDQSNSEINDDLASDDSYATRGL
ELRVQRSSVLPVSPIPFNSTHQEQPDSDKPDVAQFQQKLEQVYRIQEPPSPSTLTNKDLV
DCSVFSPPAVAGGDTFLVQVFVHLPEQAEMAKQQAQEFDSEAKQLGIRSLGLPIERGTAL
TFSLSIPNLEVDEPNQQLVWKGRAESVQFGVTVPADLTQKTVIGTITVSQNSIPLGHLKF
KLSITPAAATTAKEPQPVGDAARVYKKAFVSYSSKDRKEVLKRVQGLAVTGIEVFQDILD
LEPGDRWERELYRNIDECDLFLLFWSTAAKESKWVLKEALYALERQGKDELNPPEIIPVI
IEGPPAVSPPDELQHLHFNDKLLYLIALSN
Download sequence
Identical sequences K9WR49
gi|428314580|ref|YP_007151027.1| WP_015211574.1.75295 gi|428314580|ref|YP_007151027.1|NC_019761

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]