SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428314583|ref|YP_007151030.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428314583|ref|YP_007151030.1|
Domain Number 1 Region: 1138-1228,1270-1534
Classification Level Classification E-value
Superfamily WD40 repeat-like 6.04e-45
Family WD40-repeat 0.0027
Further Details:      
 
Domain Number 2 Region: 1011-1253
Classification Level Classification E-value
Superfamily DPP6 N-terminal domain-like 3.14e-28
Family DPP6 N-terminal domain-like 0.026
Further Details:      
 
Domain Number 3 Region: 317-395,492-660
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000000158
Family G proteins 0.086
Further Details:      
 
Domain Number 4 Region: 10-226
Classification Level Classification E-value
Superfamily Caspase-like 0.000000000000272
Family Caspase catalytic domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428314583|ref|YP_007151030.1|
Sequence length 1571
Comment WD40 repeat-containing protein [Microcoleus sp. PCC 7113]
Sequence
MVLTNTLIKAQKVATFKRSLAIVIGINEYQNRIPKLKTARRDAEVLAEILEKEHQYDEVV
LITDETEFKPTLQNLLILLEERLPKEIKPTKDDRLLFYFAGHGIARDSDKGPAGCLVPQD
ADVEKSENLLLMQKLHECLTALSCRHLLVILDCCFAGTFRWSSTRLATVIPRVVHKEHYD
RFIKSPAWQAITSAAHNQEALDVLCDNRGGANHSPFAEGLFKALRGEGDVIPAGKKGQPP
GDGVITAAELYLYLRDHVELSSQERQTPGLWTLSKHDRGEFIFLVPGADLKLKPAPKLNE
NNNPYRGLSAFEEEHSQFFFGRQELIEELYRRIAHVDENYSQLTVVLGTSGSGKSSLVKA
GLIPCLRQKYSQEWCILKPMRPGESPFSALARTILPITSVPVINLLENLDFISEILQEKL
KRLDQEIYDTFDGAEARTDKRIRLEQEENKFNQIADTWNSRTPDKRLLLVVEQFEELNNL
CRTDDERERLKQAFLDCINPLSERLQTDSKQFIEIIAAWSQQHVGVRLLLMIDQFEELIT
LSRNTQEDKQNSKPNESQQFLKLLEETLAATLPQLCIIVTLRSDFEPRFLSSEALKSHWT
QARFPVRAMRSDELRQAIERPATEMALYFEPSNLVDKLIDEVGQMPGALPLLSFTLSELY
LKLAEKWRLQETSDRALILDADFDKEGGVAGSLTRRANQEYDGLPNDAHRATMQRVMLRM
VTTEGGESARRRVPLSELVYADKQDPNKLDEEENQRVELVLERLNHARLIVSGQETGEPY
VEPAHDFLVRSWDKLQKWQQEEQEDLPLQRRLTPAALEWKTKEQSSSLLGKTEPVLSLVD
KKLDSVEDWLNHQSQKNAQEHRRERKGQFLWNGNPYLDVLKKRLKSYDYWFNQVETEFVQ
RSVWQRRRNTNLRWGIAIGVILLSSGLTIWALRELRNSLIGQISTARESSETRLRTNQLT
LNALINSLQAGKSRKHWLLWGPLQPNKLLQNQVLETLQHAVYSVKERNYWQLPKGKVLDV
FLGQDNQLFVAIKKGDETACVWDSETKTCSPLSGNLVEGAKFSPDGRMLSIFGKDRTVRL
WNLESKQIVNELAQLEGSFKNISFSPDGKQLAIKAAKKEDGSDNISYLWDLEQNRVEPLP
ENNISISFNADGHLLMATLKQMNESQTHVELLNLSSGKVSYISPEFDQIDRIDFSLDGKQ
LIITGGHDAVSSEWWRWNLENNNWEKAIEDPYLNEADQSSFSSNGKLLITTGHVVRLYSS
NPLSSSDLSVLGEFNLPQGAVENMIFSADGKHFVTQEDDGVVHLWDVEQLQPETEHQFSL
VEIEKVKIESINFSPDGQQLVTGGKDGFVRFWDLNGNELNKFQAYPNNAVKIISWAQNGQ
KIATMSDQITEKSQADTVVKVWKLSGQQSDEFSIKLGNIIDSINDINFQKNGSFRIISSA
NEGRVVWLDSSGLATTLNTKRKETYNSKSINFNADGSLFATTSFHNGTVTLWDLQGRQLM
KFQGYKGEIKNVGFSADGSKLAVVGEDGKVKLWQLGGLDELLQRGCERARDYLATLDEKN
SDRHLCDNIPR
Download sequence
Identical sequences K9WRT0
gi|428314583|ref|YP_007151030.1|NC_019761 WP_015211577.1.75295 gi|428314583|ref|YP_007151030.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]