SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428314662|ref|YP_007125555.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428314662|ref|YP_007125555.1|
Domain Number 1 Region: 491-660
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.31e-35
Family Histidine kinase 0.0022
Further Details:      
 
Domain Number 2 Region: 29-255
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000000172
Family RecA protein-like (ATPase-domain) 0.048
Further Details:      
 
Domain Number 3 Region: 430-499
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.000000000255
Family Homodimeric domain of signal transducing histidine kinase 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428314662|ref|YP_007125555.1|
Sequence length 677
Comment signal transduction histidine kinase [Microcoleus sp. PCC 7113]
Sequence
MTQVYQYQVGGSLPENAPTYVMRQADSDLYEGLKAGEFCYVLNSRQMGKSSLQVRTMLRL
QGEGIACATIDLSDIGSQLVSLEKWYGGVAYKLASSFNLFEAVEFMSWWREREFMPPVQR
LSELIEQVLLGQETQNKVIFIDEIDSILSLREPLDDFFALIRASYNKRAHKPEYNQLTFA
LLGVATPSDLIQDKHRTPFNIGRSIHLSGFDLHEAMPLAQGLVAHADNPIEVLKEILAWT
GGQPFLTQKICQLVITFPLAIATGKEAEAVGNLVRTRVIENWEATDEPEHLKTIRDRIMR
NEQRAGRLLGLYQQILQQGELAGDDSPEQIELRLSGLVVKQAGNLKAYNPIYESVFNKNW
IDKELAKLRPYSEAFTAWLASGCMDESRLLRGKALQDALAWAASKSLSGQDNQFLRASQE
WDNRERIMVLEAEKRVRDEFFATLSHKLRLRLNAIMGWTKLLRYRKFDEARTDRGLETIA
RNAESLSQMIEDLLDQSLILRGKLHLNRCPVELVPLIEAAIDTALPAIDAKKIRFESTLA
PSVGRVLGDSERLRRVIWNLLSNAVKFTPEGGYIAIRLELINCCAQIRVSHTGEGIAPDF
LPYVFDSFRQEDRTTTSHGGYGFELVSVRYLVELHGGTVHAESPGVAGGATFVVNLPLMS
DHVEAGFHEQDSIDERE
Download sequence
Identical sequences K9WQZ4
gi|428314662|ref|YP_007125555.1|NC_019740 WP_015186272.1.75295 gi|428314662|ref|YP_007125555.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]