SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428314664|ref|YP_007125557.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428314664|ref|YP_007125557.1|
Domain Number 1 Region: 621-898
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.19e-81
Family WD40-repeat 0.00013
Further Details:      
 
Domain Number 2 Region: 451-691
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.08e-59
Family WD40-repeat 0.00062
Further Details:      
 
Domain Number 3 Region: 857-1021
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 1.06e-37
Family Quinoprotein alcohol dehydrogenase-like 0.007
Further Details:      
 
Domain Number 4 Region: 11-261
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000000798
Family RecA protein-like (ATPase-domain) 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428314664|ref|YP_007125557.1|
Sequence length 1070
Comment WD40 repeat-containing protein [Microcoleus sp. PCC 7113]
Sequence
MSTPQPSTYQYQVGGSLPVDAPTYVVRQADSDLYEGLKAGEFCYVLNSRQMGKSSLQVQT
LQRLQGEGIACATIDISDIGSQQVSPDKWYGGFAYKLASSFNLFEAVEFMTWWREREMLP
PVQRLGELIEGVLLVQLTQNLVIFVDEIDSVLSLKEPLDDFFALIKACYNKRSHKPQYKR
LTFALLGVATPSDLIRDKTRSPFNIGQAIHLSGLALAEAMPLAQGLAQKTNNQKAVLKEI
LAWTGGQPFLTQKICKLVLMSSLPITAGDEGAWVENLVRAQVIENWEAFDEPEHLKTIRD
RILWSQRQGQLLQLYHQILQSGELKANDLPEQMELRLSGLVVKQQGKLRVYNRIYQSIFN
RNWVENALDEAGLLPKFASKSTPSKAEIQAIKRLASDALKQFESQQIESLLLAMQAGQAL
KALVHEGCPLQDYPTVSPLYALQTILDNIYERNKFKAHASGVNGVSFSASGQRIITVGAD
GRVRIWKLSGRQIVEWESNRGSIWSMSFSPDRQLIATAGLNGTVRLWELPGIELAHWNAH
QGTVRRVTFSPDGQVIATVGKDEVRLWNLSGQQLAQWNTSQDKVVHGTFSPDGQGFATAG
EDGTIRFWNLSGQQLDQWKVHSDGIIDVSFSPNGQQIATVSNSGKAKLWNLSGQQLVQLN
DYPLLVRKVSFSPDGQHIVTAGLDSTIELWNNSGQQLAQLKGHKGLVRSVSFRQDGQYLA
TASADGTVRLWDLSDKPVAQWNSHQSKIWSVSFKPDGQYLATAGADSSIRLWNLQGKQLA
QLDGHQGWVRRVSFSPDGQYLATAGYDSTVRLWNLEGQQIVLNGHQGRVNSVSFSPDGQY
LATAGCDGTVRLWNLEGQQLSQLNTRHGKVYDLSLSPNGQHLATAEADGTARLWQMSGQQ
LLELKAQRGRVYTLSFSPDGQYLATGGTGGTVRLWDLSGQQLAQWQSHQGTVYCISFNPN
GQQIATAGADSMAKLWDLSGRQLAQWQSPNNSVYSVVSFSPDGQCLATVGTGGLQIWRIG
GLDELLLRGCDWLKDYFVTHPEAQEKLEVCQNLISFGEANVQKTTLSWSS
Download sequence
Identical sequences K9WPW4
WP_015186274.1.75295 gi|428314664|ref|YP_007125557.1| gi|428314664|ref|YP_007125557.1|NC_019740

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]