SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428314754|ref|YP_007150938.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428314754|ref|YP_007150938.1|
Domain Number 1 Region: 424-575,641-725
Classification Level Classification E-value
Superfamily TPR-like 8.54e-23
Family Tetratricopeptide repeat (TPR) 0.0091
Further Details:      
 
Domain Number 2 Region: 49-212
Classification Level Classification E-value
Superfamily TPR-like 3.73e-19
Family Tetratricopeptide repeat (TPR) 0.018
Further Details:      
 
Domain Number 3 Region: 138-369
Classification Level Classification E-value
Superfamily TPR-like 0.00000139
Family Tetratricopeptide repeat (TPR) 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428314754|ref|YP_007150938.1|
Sequence length 776
Comment hypothetical protein Mic7113_6516 [Microcoleus sp. PCC 7113]
Sequence
MMRSEYSRLWSNSRWSRLLTCFIMCGLAGGLPLIPVDGIVPSAEAQAVPAAVRRGQSLLQ
RGLANDAIAAFQQALRSSPNSLEAKLGLAQAYQKAGKDADAWTAYQRVLEQAPNNVPALK
AVGLLGGYRPEWQVRGIEALNTLLSQNPNDNESRAQRALLLGFQGRYSESFADYQVALAN
NPTPDTLLGAAKIYTYSGNYQQALEFFRRYQATGKKITDYGVPAYAIALRKTGSTAQSVQ
VSEQELRKSKKLDGLAIELRSELAQSLAANGQVDQALATLEPLRGRQDAALPLARALTTI
GREQRRTDLYSEGVALYNSVLASTPNPNPALVREIADVLSEVPSERAQALSLYQQAAAAQ
PNNKTLQLKQLILANQLGQLSQAEFRDRLLSQFQPLPEDATDRLALAQALVPIDPPDPEL
LPIYESLLASNVDAPFLNVRVAQMYLQRNQVAQARQALAAYQATAAGANDLTPELLLADL
DRREGNLEASARRYESIINRNPSDRLLSSALRGLAGIRVAQGRADDAIAIYDQLLTRDPN
DLVVKLGRASLAYQANRMTEAEASAVLNEWLQQRPNEAPPELFTLVGALPASPEREALYN
SLLALDPDNTGVQLRRLQVIAKRDPIAAKEEVAKLIARNPNNIGAYFVQADLATALKDYE
LAIASYQEILQREPNNTGALLGLGGVRFTQQKFAEARDIYQRVLEIEPKNLIARTNLAEL
NVADDRRFTALDQFKELNAEQQAQSGQTNPELDNRIQEVEVDILKRRGFQPPWERY
Download sequence
Identical sequences K9WQQ3
WP_015211488.1.75295 gi|428314754|ref|YP_007150938.1| gi|428314754|ref|YP_007150938.1|NC_019760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]