SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428314765|ref|YP_007150949.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428314765|ref|YP_007150949.1|
Domain Number 1 Region: 21-177
Classification Level Classification E-value
Superfamily CheW-like 0.0000000405
Family CheW-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428314765|ref|YP_007150949.1|
Sequence length 184
Comment CheW-like protein [Microcoleus sp. PCC 7113]
Sequence
MAIFSPLASRRKSRRVAEVTQQLIVFRLLDVGFALPIRAVQKVIPGDKIYGAPGGGGVSL
TLYQERELIVIDVEHRIFRGTPSKDSFKDISHQAEEAPTDTAPVQHYLLIVQSSSGQLVG
LPIVEPPTLQRVPSSAFAPLSASYLSEGNLRCVSALIKRNNDQPPLFLLNPDQLVQSDLA
LPPA
Download sequence
Identical sequences K9WP03
WP_015211499.1.75295 gi|428314765|ref|YP_007150949.1| gi|428314765|ref|YP_007150949.1|NC_019760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]