SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428314778|ref|YP_007150962.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428314778|ref|YP_007150962.1|
Domain Number 1 Region: 4-375
Classification Level Classification E-value
Superfamily PLP-dependent transferases 8.7e-101
Family GABA-aminotransferase-like 0.0000153
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428314778|ref|YP_007150962.1|
Sequence length 376
Comment TDP-4-keto-6-deoxy-D-glucose transaminase [Microcoleus sp. PCC 7113]
Sequence
MSTIPFNQPFAVGKEFEYIRQAIKNVHTCGDGPFTKKCHTLLEQTLGVSKALLTTSCTHA
LEMTALLLNLQPGDEVIFPSFTFVSTVNAFVLRGVYPVFCDIRPDTLNLDENKLEQLITP
RTKVIVPVHYAGIGCEMDAIMELAGKYGIAVVEDNAHGLFGKYKGKYLGTIGCLATQSFH
ETKNFNCGEGGALLINDPQYIERAEVIREKGTNRSRFYRGQVDKYTWVDVGSSYLPSDML
AAYLYAQLEVQEQIQAKRQEIWEYYHKNIQDWAEKHGIRFPIVPDHCEQAYHMFYLLMPS
LEKRQALIAHLKAQNIISAFHYLPLHLSEMGQKFGGKEGDCPVTEDVSDRLVRLPFYNDL
TEADLARVVAAICEFD
Download sequence
Identical sequences K9WPM6
WP_015211512.1.75295 gi|428314778|ref|YP_007150962.1| gi|428314778|ref|YP_007150962.1|NC_019760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]