SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428308627|ref|YP_007119604.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428308627|ref|YP_007119604.1|
Domain Number 1 Region: 54-186,238-407
Classification Level Classification E-value
Superfamily Pectin lyase-like 1.54e-34
Family Filamentous hemagglutinin FhaB, secretion domain 0.011
Further Details:      
 
Domain Number 2 Region: 483-587
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000000033
Family Filamentous hemagglutinin FhaB, secretion domain 0.084
Further Details:      
 
Domain Number 3 Region: 406-526
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000000691
Family Filamentous hemagglutinin FhaB, secretion domain 0.062
Further Details:      
 
Domain Number 4 Region: 589-708
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000000607
Family Galacturonase 0.047
Further Details:      
 
Weak hits

Sequence:  gi|428308627|ref|YP_007119604.1|
Domain Number - Region: 717-834
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00173
Family iota-carrageenase 0.083
Further Details:      
 
Domain Number - Region: 850-897,1021-1194
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00204
Family Galacturonase 0.05
Further Details:      
 
Domain Number - Region: 771-900
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00279
Family P22 tailspike protein 0.094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428308627|ref|YP_007119604.1|
Sequence length 1378
Comment filamentous hemagglutinin family domain-containing protein [Microcoleus sp. PCC 7113]
Sequence
MIRPVFPFWRAGYLLLGCLASAKNLALPVSWRHCWPLGIGVALGISSGIAFSGNRALAQI
IPDTTLGVESSVVTPLDPDLPVDVIDGGAQRGQNLFHSFQDFNVSENRGVYFYSSDANIQ
NILARITGANRSDILGTLGTFGESQPSLFLINPNGIIFGPNANLDIGGSFVATTANAVGL
GETGRFSASEPQTSNLLAINPNAFFFNQFSNQGQIVNRSTATSTVLGFSVNGLPFTYGLQ
VLGRSLLLLGGNVNLEGGIVFAPGGRVELGGLAGAGTVRLDTNGNLLNLSFLDGVARADV
SLNNQAVLDVVANDGGSIAIHSRNINIFGNSKLWAGIWSGLGTVDSQAGDITLDATDAVT
VVDSNILNEVQEQAIGNGGNINIRAESLSLSGDSDYVIVSADTHGQGNAGSVSVQVSGPV
SLNSSRISSQVLYGAVGNSGGINIQAQSLRMTDGAELYAQVAFARGNAGDISIKVADSVE
VIDGSVIVTYAGDGAVGNGGNISLEARSLFMENNASLLAETLGQGNAGNISVQVADFVTL
IDSYFYNAAANDEEQTVGNGGNITVEARSLFMADGSELKSSTDAQGNAGNILVRATDSVE
LIDSHILSHVELDDRSYIETVGNGGDITIETRSLSLTDASLNASTQGQGHAGSIFVRGAD
SVLLSDSSISTAVKTEGIANQPSNIEIHTRSLALTNNSQIDATTSGRGDGGTVSVIAPGG
SISLANNSSIKTAVEVGAIGQGGDIKLTANSISLTGGSRLEAQTRGEGDAGNIQLDATEF
VDISGANPLGLSSGILTSTETSNSGKGGKITVGLPHGSLDSLRLSDGSVLSARTLNSAPG
GDIEVNVDQLEITTGGQIITSASSLGSAGNINIRATESVTISGSNPNFIDRGGSTGNTGN
GIGRVSEIEPNNSIAEAQFIAPELFSLQANPDIEASTDIPHVSIFGTGDGTFDYYSLMIQ
APGSRGIFEIDNSSAAGTGYLDTQIFLFDSAGRRLTQNDDSSTALGAGGSTSRLDSFISY
EIETPGIYTIGVGRYFSFAGNGSIAGNPLAPGNQYTLQVSIDNRNTNPNQNPNSGLFAQA
TNGGTAGNLTIETGQMFVRDGGQVTVSSPQGQAGNLSITANTLTLNQGTISAVTGTSGAE
GGANITLKGLDFLRMDNESLISASALGNANGGNVTIDSTFIVATPPTGPEGSDIIANAEQ
GNGGRVYVTTQGLFGIQFRPQRTPKNDITVSSTFGLSGEFALNTPGVDPSRGLAQLPVNV
VDASQQIDQRCTPKAANQGGSFTVTGRGGIPPSPNDTLQAESLITPNWVILDSERENNTS
SAPTTPSNSAPKQLVEAQGWRINEQGQVVLTASAPNVTPHNTWQTPVECTADANPVQK
Download sequence
Identical sequences K9W7L1
WP_015180362.1.75295 gi|428308627|ref|YP_007119604.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]