SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428308982|ref|YP_007119959.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428308982|ref|YP_007119959.1|
Domain Number 1 Region: 557-749
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 5.24e-40
Family Histidine kinase 0.003
Further Details:      
 
Domain Number 2 Region: 321-433
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.12e-25
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.018
Further Details:      
 
Domain Number 3 Region: 24-149
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000127
Family N-terminal PAS domain of Pas kinase 0.068
Further Details:      
 
Domain Number 4 Region: 167-306
Classification Level Classification E-value
Superfamily GAF domain-like 0.000000706
Family GAF domain 0.03
Further Details:      
 
Domain Number 5 Region: 468-508,538-568
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.0000726
Family Homodimeric domain of signal transducing histidine kinase 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428308982|ref|YP_007119959.1|
Sequence length 759
Comment histidine kinase,PAS domain-containing protein,PAS domain-containing protein,histidine kinase [Microcoleus sp. PCC 7113]
Sequence
MLPLQLDPQRIALTHWDNTLSEALFQDLPLGILVMEAQGEIRFVNQAALNLLGLSESQLF
GQTPVDPDWHIIQENGKPFQLKLQSVPVRAKHTLMLLVSRQPLRNLVLGVYRPLLRDRVW
LSINTEPKLGLDGCVERVICTLSDITNLKAEEKLSRLHECFLSLESDPDENINRLTALAG
ELLGGTWAVYNRLNQGLLWSLGQWQTPANYMHVGEPKHNICHEVIQRGSNQVFVLQDLQN
TSYAHNNPDILTHQLQTYIGQAVKCAGEYIGALSVVYQNPFIPSQGEKTLMGIIAAAIGV
EEEHKREATVWAQNEAKWRSLIQTSSNLITILEANGTIKYASPAIRGVLGYKPKELMGQS
LFELVHPEDLVNIEQNFQGFLQNPTTDLSLEFRFRHQDGSWRYIESTYSNLLMDSPVTRI
VVNFRDVTERKRAEEAIKQSEAQLREKATQLENTLHELQETQTQLIQTEKMSSLGLLVAG
IAHEINNPVSFIYGNIPHATQYTQDLLHLIELYRQQYPHPAPIIQAEEESIDLDFLSEDL
PKLMNSMQMGAERIRQIVLSLRNFSRLDKAAREPVDVHQGIDNTLLLLQHRVKAKAGRPK
IEIVKEYGELPLVECYAGQMNQVFMNILGNAIDALEELNVERSQVEGLSHDVQSNQEQPP
TPCIRIRTQLKDDNTVLIRIADNGPGMTAQVQQQIFDPFFTTKSVGQGTGLGLSISYQII
VDKHGGQLKCASTPGEGTEFWIELPVMLPHEPLKDAKAL
Download sequence
Identical sequences K9W8K6
WP_015180716.1.75295 gi|428308982|ref|YP_007119959.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]