SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428309480|ref|YP_007120457.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428309480|ref|YP_007120457.1|
Domain Number 1 Region: 820-1003
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 3.14e-41
Family Histidine kinase 0.00049
Further Details:      
 
Domain Number 2 Region: 486-613
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 6.28e-24
Family Heme-binding PAS domain 0.06
Further Details:      
 
Domain Number 3 Region: 612-741
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 6.28e-24
Family Heme-binding PAS domain 0.069
Further Details:      
 
Domain Number 4 Region: 213-325
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 8.2e-20
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.021
Further Details:      
 
Domain Number 5 Region: 69-192
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.61e-19
Family Heme-binding PAS domain 0.013
Further Details:      
 
Domain Number 6 Region: 752-832
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 2.75e-17
Family Homodimeric domain of signal transducing histidine kinase 0.0023
Further Details:      
 
Domain Number 7 Region: 319-448
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000000297
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428309480|ref|YP_007120457.1|
Sequence length 1004
Comment PAS domain-containing protein [Microcoleus sp. PCC 7113]
Sequence
MTRLNLDDFAKQIQDWCQRLAQLQQLTGESPSTPQQQEIILTAVEGLSTAFEELQVANEE
LYQQHEKLLMTQQALIAERQRYQQLFEFAPDAYLVTDVNGVIQEANRAAATRLNHSQQFL
VGKPLACYVVKEERRAFRNQLNQLRQVEGVQEWEVSLRSPDQTPLITALRVGTIQSPEGQ
PMGFRWLMRDITEHKRIELELRQAHERLHLAANALDGIIYDWNVENGTVDRTQGLVEVLG
YRPEEAQPTLDWWTQFIHPDDRQPVRQVISNALANSSAFDTEYRIRDKNYQYLHIWDRGQ
IIRNASGRAVRVVGSTLNISGRKQAEEQAQQSAAEIRQIFNMLPSLVWKFCPTRFQFVYI
SDMMAELSGISREAFLENPQIWDDRVDLGNESQEALRISWEAIRKGESYRVIYRFHTLHR
GVRWFEVIGRAVDEEGVLYYYGSTTDITECKQAEESLHRLNQELENRVKERTSELEQLNH
QLLAEIAERMSVEAALHQREQEYRALVEHAPDIIERFDPQGRHLYVNPAIESVTGKPPNE
FIGKTNRELGISEPNLAIWEQALSRVFQTGEEQQFEFSLVTAQGLKYYQTRLVPEMETDG
NLISVLGMTRDITDHKLAIEALRESEDGFRQLTENINEVFWMVTPDFSERLYISPAYEQI
WGRSCQSLYDQSNSWSEAVHSEDREFLIGKQEQESRGEVTDVEYRIVRPDGSMRWIRDRA
FPIYDAQGQVYRIAGIAEDITCRKQAELESYKVLQRERELSMLKSSFVAMTSHEFRTPLT
AISSSTDLLERYRNRLSEEKQQAHLHRIKSAVLRMTQMLNDILLMSEAEAGKLQFNPAPL
NLVQFCRHLVEDVQPTAKEQQVIHFTYRSDGTIAGQDSDEIKQKRFDFLSGLALWDEKLL
RQILGNLLSNALKYSPEGGTVQFDLTAKNDRVIFQIQDQGIGIPPADQSRLFEAFHRANN
VGTIQGTGLGLAIVKQCLDLHRGEITFTSEVGKGTRFIITLPLS
Download sequence
Identical sequences K9WB63
gi|428309480|ref|YP_007120457.1| WP_015181211.1.75295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]