SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428309513|ref|YP_007120490.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428309513|ref|YP_007120490.1|
Domain Number 1 Region: 7-265
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.05e-56
Family Protein kinases, catalytic subunit 0.00017
Further Details:      
 
Domain Number 2 Region: 1610-1774
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 3.27e-42
Family Histidine kinase 0.00097
Further Details:      
 
Domain Number 3 Region: 1799-1931
Classification Level Classification E-value
Superfamily CheY-like 4.98e-37
Family CheY-related 0.0034
Further Details:      
 
Domain Number 4 Region: 1343-1522
Classification Level Classification E-value
Superfamily GAF domain-like 7.85e-25
Family GAF domain 0.0044
Further Details:      
 
Domain Number 5 Region: 1541-1622
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 3.92e-22
Family Homodimeric domain of signal transducing histidine kinase 0.0011
Further Details:      
 
Domain Number 6 Region: 293-577
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.04e-18
Family G proteins 0.075
Further Details:      
 
Weak hits

Sequence:  gi|428309513|ref|YP_007120490.1|
Domain Number - Region: 1219-1293
Classification Level Classification E-value
Superfamily TPR-like 0.00291
Family Tetratricopeptide repeat (TPR) 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428309513|ref|YP_007120490.1|
Sequence length 2011
Comment ATPase [Microcoleus sp. PCC 7113]
Sequence
MSITIVGYNLLETLYEGTTTCVYRASRESEQVSVIIKTLKAEYPTLEQLTRLRHEYQILQ
SLEIEGIVKPLGLENYQNGLALILSDLGGESLKNLIADKSLDLSLFLQIAIQLASTLAQL
HQNNIIHKDIKPHNILINAKTSQVYIIDFSISSCLSKENQTVINPNVLEGTLAYMSPEQT
GRMNRSIDYRTDFYSLGVTCYEMLTGHLPFEVTDPLELVHCHIAKTPVPPHLINSEIPEV
LSEIVMKLLAKTAEERYQSALGLKADLEICLKMLQTSGEISRFKVGELDLFSQFYIPQKL
YGREQEVSLLMDAFERVSNPSQKQRGVEMMLVSGYSGIGKSSLVNEIHKPIVAARGYFIS
GKFDQFQRNIPYSALIDTFQSLVKQLLTESEAQIAQWREKILAVLGTNAQVIIDVVPEVE
LIIGKQPAAPELAPTEAQNRFNLVFQNFIRVFCSQEHPLVIFLDDLQWTDSATLKLLEVI
MTDAETGYLFFIGAYRDNEVNRAHPLMITLESLRSQGVIINNIILAPLALDHIRNLIADT
LHSNTLTVKPLAELVIRKTSGNPFFVNQFLKTLYQENLLTFTPPSQDSQAFWQWDISNIE
AMGITGNVVELMIRKLRKLPDSTQQVLQLAACVGNTFDLQTLSIIYKRSAAVAYRHLWGA
IQEGLILPISGLKSLPEDIIDTHLVSLEFKFLHDRVQQAAYALIDEQFKQATHLQIGRLL
WQNTESEALLEKIFEIVDHLNLGIELISDESERTEIAKLNLMAGQKAKAASAHAAATKYL
QAGLALLADFSWDTEYELILSLHTEAAEAAFLNGDFEAMQRLAQIVQNCAKTLLDTVKVY
EVQIQAYMGQNKLLEALNTGLLVLKQLGIEFPNSPNPSDIGQALGETATILSTTRIKDLI
DLPEMTNPQQLAVIRILSSIFSACYSTVSSLVPLTVCKQVNLSVQYGNAAVSPFAYAVYS
LLLCGAIGDIERGYEFGQLALRLVSKLNAKEIEAKTCHLVTSGVQHWKEHAKNTLASFLS
VFSTGLETGDLEYAGYAIMVWSHYSFFVGQPLTQLERDIATYTDAIQNISQETALNNTKI
CWQTVLNMLGRASNRCQLKGEAYDEEKMLLLHQQTNDQLAIHYLSLHKLVLYYEFEDYPE
ALKIIPQIESSFGASVGQLTVVIFYFYDSLVRFAMYSEASQSVSEAAAKSQQQCILDRVQ
ANQEKMQKWAHHAPMNFLHKFYLVEAERHRVLGEKVEAMEMYDKAIALAKENEYINEEAL
ANELAAKFYLSWGKETIAQLYMQKAHYAYQVWGAQRKVEDLEEKYPQLLPRTSARNRTQT
TVNQTTNSPSTTSQSRTSTSLDLATVIKASQAISGEIVLSNLLSQLIGIAIENAGAEKGI
LILNKSGQLFIEAQIDLEQNDVILLRSIPVGDGNHLPISIINYVERTHKDVVLKNASASS
IFSKDIYILSNQPKSVLCTPLIHQGKLIGILYLENNLITDAFTSDRLEVLTLLSSQAAIS
IENASLYTDLEEALQNLETKVEQRTLELQENNIRLQQEIHERQRAEEAAEAANRAKSEFL
ANMSHELRTPLNGILGYTQIFKKYKNLTEQQKNGIGIIHQCGEHLLTLINDILDLSKIEA
RKLELYPKEFHFPEFINGIYEICRIRAEQKGIELIYETLSPLPQAIQADEKRLRQVLINL
LGNAVKFTEKGSVTFKVGYQEGKLRFQVEDTGIGIAQQQLEEIFLPFQQVGEESRKTEGT
GLGLAISRQLIELMNASINVNSILGKGSIFWFDLDVTEVAFRDNLAKDLERTISAFKGNK
RKVLVVDDKWMNRSVLVNILEPLGFELFEVSNGLDALNKAHEIKPDVIFMDLVMPVMDGF
EATRRLRTLPEFKDIVVIAISASVFNFDRQQSQEVGCDDFLPKPIREAELLEKLRLHLGL
EWIYEETTNDSPEQQEVHPQSQISQSQFIVPPAPEVAALLDMARRGDLRGLAKRATQLEE
LDPQWVPFATHLRELAKEFKGKQIREFLKQF
Download sequence
Identical sequences K9WBF8
WP_015181244.1.75295 gi|428309513|ref|YP_007120490.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]