SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428310185|ref|YP_007121162.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428310185|ref|YP_007121162.1|
Domain Number 1 Region: 600-783
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.15e-37
Family Histidine kinase 0.0000152
Further Details:      
 
Domain Number 2 Region: 1015-1135
Classification Level Classification E-value
Superfamily CheY-like 1.42e-32
Family CheY-related 0.00062
Further Details:      
 
Domain Number 3 Region: 9-130
Classification Level Classification E-value
Superfamily Histidine-containing phosphotransfer domain, HPT domain 4.58e-24
Family Chemotaxis protein CheA P1 domain 0.0091
Further Details:      
 
Domain Number 4 Region: 785-959
Classification Level Classification E-value
Superfamily CheW-like 0.000000000201
Family CheW-like 0.0032
Further Details:      
 
Domain Number 5 Region: 427-484
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.0000902
Family Homodimeric domain of signal transducing histidine kinase 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428310185|ref|YP_007121162.1|
Sequence length 1137
Comment chemotaxis protein histidine kinase-like protein [Microcoleus sp. PCC 7113]
Sequence
MTNDPSIREQSYRYFLQEAPELLQVLEQDLLTLREDYSINKIHNLMRTTHTLKGAAASVG
LETIKTVAHSLEDIFKALFNPDLSIDPDIEALLFEGYECLRLPLNAELTGGNINDGEILD
RTAAIFAQLQEKLGDCFGAESHIPSSIELGFDVTQSIFEVGVNQRLEEISAVIASAEPAA
VATTLRTQSEVFQGLAESLNLPGFGAIAEATARALDDHPDQVMLIAQTALADFQTGQEAV
LNGDRTQGGQPSALLQQLSGLQPSTEIEIESLEVPDEDSVLTSDWTESGTDLFNYSGVEV
EVYSESSLSNELQSPDFSAFESFSLSDTVPEVVSDAQESDTFQTATWTSQSEVHSFRSAS
DSELNLGESPKEASPNLLLESIWGETEETDTGREREIHPQAEEVTASSRHRVSSPSTSAT
PPNSISRTVRVNVEHLEHLNYAIGELLTNQNRQSLENEQLKASVRTLLARLQQHQQQLNE
LQDWSDRQFIDVEQRQMGQRLQRERLSVEGGALGVAGTAAWTSVRPVTLTLPNPEHRFDS
LELDRYTEVQLLVQSILEDAVQLGEATEAIDLFTKQSQQTLEKQRRLLSGTRDALMEARM
LPLAEIFGRFPRVLRQLEVSHNKRVELELQGTEVLVDKLVAQKLYDPLLHLVRNAFDHGI
ESSSIRQKRGKPQKGQISISASHRGRHLVIEVRDDGQGLDFDKIRQRAVEQQFSPERVSA
LNEAQLTDLLFEPGFSTASEVNDLSGRGVGLDVVRAQLDSLQGSVGVESEAAKGTTFTLQ
IPLNLTIAKLLICQSGNHIYALFTDAIVSILIPQANQIRAWEGGKVLRWNQGIDGFSKAA
VSELEKLSANAPTSERLIPVHSLANVLDYFSSPSPLNFQPKPSFLHQEQTRPVILLRCVK
QGYPVGEDTLIGLEVDQLIGEQELVIRPLGGMMVPPSYVYGGSVLADGRLTLVLDAAALS
QYVLEQQTGRGTEEHFATSTAHLLSGSPQQRLLPPQHRAALPPPPPAEVRTKQNKMVLLV
DDSITLRQTLSLTLQKAGYPVLQAKDGYEAIEQLRVHTDVELVICDIEMPRMNGFEFLKH
RQQDSALGTIPVVILTSRSGEKHRLIATELGATGYITKPFLEHQLLETVNSVMEKQS
Download sequence
Identical sequences K9WD79
gi|428310185|ref|YP_007121162.1| WP_015181908.1.75295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]