SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428310666|ref|YP_007121643.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428310666|ref|YP_007121643.1|
Domain Number 1 Region: 906-1070
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 3.93e-44
Family Histidine kinase 0.00088
Further Details:      
 
Domain Number 2 Region: 573-701
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 4.89e-28
Family Heme-binding PAS domain 0.039
Further Details:      
 
Domain Number 3 Region: 446-574
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 2.54e-27
Family Heme-binding PAS domain 0.07
Further Details:      
 
Domain Number 4 Region: 278-408
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 2.09e-25
Family Flavin-binding PAS domain 0.076
Further Details:      
 
Domain Number 5 Region: 700-827
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 5.23e-25
Family Heme-binding PAS domain 0.034
Further Details:      
 
Domain Number 6 Region: 177-284
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.11e-23
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.018
Further Details:      
 
Domain Number 7 Region: 27-129
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 2.74e-19
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.044
Further Details:      
 
Domain Number 8 Region: 835-918
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 1.63e-18
Family Homodimeric domain of signal transducing histidine kinase 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428310666|ref|YP_007121643.1|
Sequence length 1072
Comment PAS domain-containing protein [Microcoleus sp. PCC 7113]
Sequence
MNAPKFPIEDNENSAKAESALNRFLTLSFDLFCITQENGYFQQINPAWENVLGWTVSDLQ
NIPWLELVHPNDRELTLNTENLHRQNNFVEYENRYRHKDGSYRWLSWRVSNAEDGLVYRV
AKDITTAKQVEDVAIFSAQSRNDFANQPVELDLQRAVAELTEWKNRYEAAGQINGLLLYE
WNSQTEEIIWGSNVEQVFGYAQEELSGSLEQWMELIHPDDIEKVIQELNRVIATKERLHV
EYRMRQKDGSYIILEDNGTFYTDNAGHLNRMVGFIANITERKRAQAELQKAYQQLELLVD
NSPLAILEWDKDFRLQRWSKQAEKIFGWKTAEVLNRHPKEWQFVYEEDAPTVDQILSQLM
DGTLQRTVDENRNYTKDGKIVYCQWYNSALFDESGNLVSIFSLVLDISDQKQAEATLQQV
MNELETRVEERTAQLQHINEQLSAEIAERQRTEAALRQSEEQFRRVFNEAPIGMGVTAKD
KRFFRVNQALVEMLGYSESEFISLTCEDITHPEDWKRLLPYLKQIEQGELDRFQVEERFI
KKNQEILWGNLTSMILRDESGKILYGLGMVEDITERRQAEAALRQSEEQFRRVFDEAPIG
MSLAGLDNRYIRVNQAFYEMLGYTESELMALTFEAITYSEDLALEIPCMEQLISGKIDSF
ELEKRYQKKNQEIVWVNLTLIALRDQSGCILYTLAMIEDITARKQAQEALQQSEARYRAI
IEDQTELICRYQPDGTLTFVNDAYCRYFHKQRSELIGYSFMPVIPEEDQALVTQSFSFLG
VEQPIVTHEHRIILPCGENRWQQWTNRALFDDFGNILEFQAVGRDITKLKQAEAEIVQAL
ERERELSELRSGFVSLVSHEFRTPLTTIQSSAELLERYNHKLSEEKKQNHYRRIQNAVQR
MTQLLEDVLTIGKAEAGKLKFTPSPINLVAFCCDLVESLQMSAKPQHQLDFVVIGEARDA
QMDEKLLSHILTNLLTNAIKYSPDGGTVKFDLVCDRTWVMFRIQDSGIGIPPQDLERLFE
SFGRASNVGAIPGTGLGLAIVKRCVDLHEGEITVESEVGVGTTFTVTLPLQS
Download sequence
Identical sequences K9WFD6
gi|428310666|ref|YP_007121643.1| WP_015182386.1.75295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]