SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428311151|ref|YP_007122128.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428311151|ref|YP_007122128.1|
Domain Number 1 Region: 10-149
Classification Level Classification E-value
Superfamily CheY-like 4.27e-42
Family CheY-related 0.00049
Further Details:      
 
Domain Number 2 Region: 408-505,534-605
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 6.15e-40
Family Histidine kinase 0.0034
Further Details:      
 
Domain Number 3 Region: 151-280
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.1e-21
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.074
Further Details:      
 
Domain Number 4 Region: 319-360,390-422
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.0000000196
Family Homodimeric domain of signal transducing histidine kinase 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428311151|ref|YP_007122128.1|
Sequence length 611
Comment PAS domain-containing protein [Microcoleus sp. PCC 7113]
Sequence
MGKKTSITSNNKEPRILLVDDKPTNLRFLSQILIERGYKVQRAISGQLALNAAIASPPDL
ILLDIIMPDMDGNEVCRRLKSRDETKEVPIIFLTALNETVEKVKAFKGGCVDYITKPFQV
EELLARIENQLTIQRLSQQLKQQNSRLQQEISDRKRADEKLRRSEANLATAQRVAHVGSW
EFDVITQKITWSEELFRIFGLDPRDPEPNHAQLLKKVHHDDRALWKKLIEQVLKSGKSYE
SDFRLVRPDCSIRYVEARGKAIFNEQGQVIRLFGTILDITERKLVEKALRESEARKQEKA
REVELTLSQLKRTQAQLIQAEKMSSLGQMVAGVAHEINNPVSFIYGNLHVAREYFQDLSR
LIEIYQQTYPNPTPEIQQIIQEIDWFFLVNDWQKLVNSMEVGAERIHQIVRSLRLFSRLD
ESELKSVDIHEGIDNTLLLLQHRLRSKGDTPEIEVIKNYGQLPLITCYASQLNQVFMNLL
SNAIDALENQAVPRRITIFTQVRDGGWEPQKSGDKTEQKTSIQSPSFPEEIPHFVVIRIA
DNGTGMNQKVQHQIFDPFFTTKPVGSGTGLGLAISYQIVVEKHQGHISCISTPGQGAEFI
VEIPVRAKADH
Download sequence
Identical sequences K9WGS5
WP_015182871.1.75295 gi|428311151|ref|YP_007122128.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]