SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428311862|ref|YP_007122839.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428311862|ref|YP_007122839.1|
Domain Number 1 Region: 627-717,769-839
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.24e-33
Family Histidine kinase 0.0012
Further Details:      
 
Domain Number 2 Region: 270-368
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 5.06e-29
Family Flavin-binding PAS domain 0.041
Further Details:      
 
Domain Number 3 Region: 140-252
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 2.42e-27
Family Heme-binding PAS domain 0.048
Further Details:      
 
Domain Number 4 Region: 554-636
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 1.73e-17
Family Homodimeric domain of signal transducing histidine kinase 0.0022
Further Details:      
 
Domain Number 5 Region: 402-548
Classification Level Classification E-value
Superfamily GAF domain-like 6.54e-16
Family GAF domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428311862|ref|YP_007122839.1|
Sequence length 846
Comment PAS domain-containing protein [Microcoleus sp. PCC 7113]
Sequence
MREAKRLLLSSYGVPVLASLLALLLRSLLAPLLRENAPLLVFIIPVMISAWYGGLKPGLL
ATAISALIGCYFFVQPVFSLDITGVANGVRIGIFLVEGVLISWLSETRRGAMQRSEAIAS
SLRESEESYRLLVEGVEDYAIFRLDPKGNIVTWNNGAERIKGYKAADILGQNYSILFTVE
DIERHKPEQALLMAVREGHFVEDSWRRRKDGSLFWASTTITALRNESGKLCGFSNVIRDI
TQRKQAEEELRKLVKDLSDVKFAIDRAAILATTDERGNITNVNDKFCELSQYSREELIGQ
NHRLINSGYHPQEFFANLWSTIKRGDVWHGEIKNRAKDGSYYWVDTTIVPFLDDAGQPFQ
YLAIRFDISDRKHAQEVLHRYAQRLEALHEIDRAILRAESTKQLARAALLRLHSVVPYEQ
AMVVLFRFQTQEAELLTREWNGELRRETIPISDLIPIQVSLQQVSIRYIENLSTLAPCPP
LLERQLAEGKRSFLSISLIAEGELIGELGVFARPVAAFTQEHQEIVTEVANQLAIATQQA
RLREQRQNYAAELEQRVIERTAELQEANEALEVFVYSASHDLRAPLRGIQGLAQVLLEDY
GDLFDSEGQLYAQRLVLSAQEMSALLQDLLDYSRLSRAEINLQRIDLASIMTSALTQLQT
ELQAQKAQVRVEIPCFEVMGHRATLIQVVTNLITNAIKFVPPGVQPQVRIWAEERGVGDE
EHQNVSADENMTQLQPRDENKTLLPDIRTPSRYAIPNNQVTPVAAVSANIRLWIEDNGIG
IEPRHQENIFQAFERLHGVETYSGTGMGLAIVRKGVERMGGRVGVESQFGDGSRFWIELR
QTTSTA
Download sequence
Identical sequences K9WGV2
gi|428311862|ref|YP_007122839.1| WP_015183574.1.75295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]