SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428312067|ref|YP_007123044.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428312067|ref|YP_007123044.1|
Domain Number 1 Region: 460-635
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 3.67e-44
Family Histidine kinase 0.0013
Further Details:      
 
Domain Number 2 Region: 656-781
Classification Level Classification E-value
Superfamily CheY-like 5.69e-30
Family CheY-related 0.0057
Further Details:      
 
Domain Number 3 Region: 219-412
Classification Level Classification E-value
Superfamily GAF domain-like 1.86e-19
Family GAF domain 0.0065
Further Details:      
 
Domain Number 4 Region: 69-194
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 7.5e-17
Family Heme-binding PAS domain 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428312067|ref|YP_007123044.1|
Sequence length 785
Comment PAS domain-containing protein [Microcoleus sp. PCC 7113]
Sequence
MNLDELTPKIEQWFSRVTELLQQKEVVTDTPSPSPEEQRQLLREACEELHIALEELSIAQ
AELLQQNQELIFTREAVEVQRQRYVELFDLAPDAYLVTDVNGKIQEANRAAASMLNIESR
FLVGKPLSIYITQSERQRFYALLIQLAQVDRVQEWEVSLQPRYDKVLNAALTVTPVREPG
GKVMALRWLLRNITERKQMERQQRLLIREQAAREAAEAQAEQSAFLAEASHLLASCLDYP
TTLNQVAQLAVPTRADWCFIDLVENNPTLFNQPVVAATDAEQKSRILERRENELLPFEGD
YGVARVLETGEPELITDIPDAFLVSIARDATHLELLRQFNAKSYMIVPLIAREQTLGTMV
FVSSKPQRRYSRIDLMMAVELAQRCAIAMDNARLYQEALQANRIKDEFLAIVSHELRTPL
NAILGWVTILRNRTVNAVTTHRALETIERNAKSQKKLIGDILDISRIIRGKIRINTYPVH
LDYIIGAVVENVRPTAELKEIQIESMLDPSVGSVMGDLERLQQIVWNLLSNAVKFTPQGG
RIEVRLEQGTGDPWGCPYAQISVRDTGKGIRPEFLPYVFEYFRQADGTTTRPYGGLGLGL
AIVRQLVEMHNGVVYAKSEGEGKGATFIVQLPMIDSQQKQPPQKYRVLLDNFPALDGLRV
VVVDDCTDTLELIAFILEQCRAQVQTATSVEEAIQAIAQLKPDILISDISMPDEDGYSLI
RQVRTLEVDQGKPILAVALTAFVREEDRTRTLDAGFQMHLPKPIEPIELVAVVANLTGRS
QSSDA
Download sequence
Identical sequences K9WHI6
gi|428312067|ref|YP_007123044.1| WP_015183777.1.75295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]