SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428312078|ref|YP_007123055.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428312078|ref|YP_007123055.1|
Domain Number 1 Region: 580-752
Classification Level Classification E-value
Superfamily GAF domain-like 1.7e-45
Family GAF domain 0.00039
Further Details:      
 
Domain Number 2 Region: 869-1040
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 6.81e-41
Family Histidine kinase 0.0032
Further Details:      
 
Domain Number 3 Region: 30-194
Classification Level Classification E-value
Superfamily GAF domain-like 3.27e-22
Family GAF domain 0.0067
Further Details:      
 
Domain Number 4 Region: 441-562
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 7.63e-18
Family Heme-binding PAS domain 0.019
Further Details:      
 
Domain Number 5 Region: 322-442
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 8.05e-18
Family Heme-binding PAS domain 0.031
Further Details:      
 
Domain Number 6 Region: 222-328
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.11e-16
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.036
Further Details:      
 
Domain Number 7 Region: 767-815,848-874
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.00000000863
Family Homodimeric domain of signal transducing histidine kinase 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428312078|ref|YP_007123055.1|
Sequence length 1043
Comment PAS domain-containing protein [Microcoleus sp. PCC 7113]
Sequence
MTNARGHNVEPSTSWQTDGVAVHTYPNLLQGVAQATNQLLTTDDLATAINQTLAILGQVT
HVDRVYIFEIHPHTETAEPAMSQWCEWARETVTAEIDNPQLQNLPFASVGMSRWYGALSD
GHSCHGLVRDLSLPERQLLEPQGILSILVVPIPVNGNLWGFIGFDDCHSEHQWSPDESAV
LMTMAAMIGSCITHRQTADALKQSQLRLEQITANVPGMIFQFLQRLDGSRSVLYASSGCQ
EIYELEPEAIQADFQMLSNLIHPDDREAYERSVANSAAKGEPWNWEGRIITPSGKLKWVQ
GTSRLEQQRNGDLFWDGVLVDITDRKQAEGGLRASEARLQSFFDATFEAVMIHDRGLILD
VNSATEALLGYSKAELVNQSVLKITAPCSQPIIQIRAQFPCDDPLEVVGLKKDGTTFIAE
ISAKSISYQGRTARVVGIRDITVRKQAEDALRQSEARNRALLHAIPDLIFRLSREGIYLD
CHAENANDLVVPARELIGKKVEEVLPAPLAQEIRQLMAQALSCRTIQTLEYQLPIDGTLR
YWEARIVVCGEDEVLVIVRDITERNRAQEDRLLTAQRAREAAVRHRLLGEIALRIRQSLD
LERILQTTVAEVRQFLECDRVFITHFDKRLQGNIAAESMAPKWGSVLEVLRGNSVYIREL
QALFESDDLQVIDDTTQADISPLRTHYFGQYQVKACLAVPIMISDKKLFGVLVAHQCDRT
RHWQPFEVDLLKALSTQVAIAVQQSQLYEQVQTLNTNLERQVEERTQELKQKYTELQELH
RLKDIFLHAVSHDLRTPVLGWLMVLNNLLHRQESDGLSVGKSQELKVSQLNIEGSDESLQ
PCQPESIPVSRSVLERMMQSSDRQLRLINSLLEVHASEVAGVALQCDPIQLGELVRILVE
DFEPLLAKNQATLMNLVPANLPLISADAGQLRRVFENLLNNALNHNPPGITIRLEAQVKE
EMICCTVADNGVGMSQEMCDRLFQLYFRGKDAKNFSQGHRPYTGLGLGLYLCRQIITAHG
GEIGVKSRPEQGTTFWFTLSVLL
Download sequence
Identical sequences K9WIQ5
gi|428312078|ref|YP_007123055.1| WP_015183788.1.75295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]