SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428312453|ref|YP_007123430.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428312453|ref|YP_007123430.1|
Domain Number 1 Region: 629-810
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 2.75e-37
Family Histidine kinase 0.0000161
Further Details:      
 
Domain Number 2 Region: 976-1095
Classification Level Classification E-value
Superfamily CheY-like 9.82e-32
Family CheY-related 0.0011
Further Details:      
 
Domain Number 3 Region: 813-955
Classification Level Classification E-value
Superfamily CheW-like 1.96e-25
Family CheW-like 0.00031
Further Details:      
 
Domain Number 4 Region: 366-487
Classification Level Classification E-value
Superfamily Histidine-containing phosphotransfer domain, HPT domain 7.07e-23
Family Chemotaxis protein CheA P1 domain 0.0018
Further Details:      
 
Domain Number 5 Region: 4-114
Classification Level Classification E-value
Superfamily Histidine-containing phosphotransfer domain, HPT domain 2.75e-16
Family Chemotaxis protein CheA P1 domain 0.0079
Further Details:      
 
Domain Number 6 Region: 185-295
Classification Level Classification E-value
Superfamily Histidine-containing phosphotransfer domain, HPT domain 0.0000000000000089
Family Chemotaxis protein CheA P1 domain 0.0059
Further Details:      
 
Weak hits

Sequence:  gi|428312453|ref|YP_007123430.1|
Domain Number - Region: 528-572
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.0051
Family Homodimeric domain of signal transducing histidine kinase 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428312453|ref|YP_007123430.1|
Sequence length 1096
Comment chemotaxis protein histidine kinase-like protein [Microcoleus sp. PCC 7113]
Sequence
MIEDEELRNLYQISSEERLQQLKSGLQYLQKYPDDETTLKELRREAHSLRGDSRGVGVES
VETLVYWVEKIFGHLIRQQIVFTPQLNNRLEQGLAAINRLVQEAVTEQPSGVDIDGVIEG
LTGIISEAQKPPSDASLDAKVDQKWELTLHQGAVPFAIAPGDAALSEIANINNETAQSVS
ALIEDETLRELYHITSLERLQNLEAGLRNLTLYPADETILETLQREAHSLTGDSKSAGVE
TVEILARSLEEILLNLKHQQIVLTQKLIDCLEQGLTAIHRLVEESVTGQPSGVDVTEVFD
YLMEVVLELQQLQPDAVPSDEEEKEDQEDFHFQPTIDDHTHPFITPLLKSEFKGNVTQIP
STFIEDEEFRDIYRTTSEERLQKLEAGLLHLEKHPDDETTLEELLREAHSLKGDSRSADL
ESVETLTHAVEDVLLCIKKQQIILTSEVSDRLYQGLDAIAFLVHEAVTGQHSNVDTPAVL
KQLMAVVAALPLPESLSVPPETPAAIPTIATQDIPTPSIGASEPYRIDTIRVPTRELDAL
MTQAEELTVTKIQIAHATAEIEELARLWNKWKAFNKKQHRQSSSLATNPYQESIQKAIDS
LSLLAQDNSTKLNLIAEDLKEKIGNLRLLPLSTLFQFFTRTVRDLAKQQGKEVELIIEGG
ETTADKRILEEMKDSLMHLIRNAIDHGIETPAEREKLGKPPIATIWLRGYQSTHHIVIEI
ADDGRGLDIKKIKQTAVKRKLYHPEQLENMTSSQVYSLIFAPGFSTRTFITEISGRGIGL
DVVRTNVERLKGSIQIESTPGQKCTFRLQLGKSLATLNTLLLKVQGIIYALPMEYVPGSL
LVSQDEISIIKGREMITWDGEKVPVVDLGDLLQLSNSPGYISRPKVEQQTSELRTCIILK
VGEEQAGFFVDRLLDTQEVVIKPQSQLLKRMHNILGATILPSGEVCMILHPPDLLKSLQK
QSPSTVQIKPNKIIPRKPSILLVEDSIYVRTQEQRLLEKAGYEVVIAVDGLDGYRQLKKR
NFDAVISDVEMPNLDGLSLTTKIRQHPEYQDLPIILVTTLNSDEDKRRGADAGANAYVIK
GKFNQEFLLETLEKFV
Download sequence
Identical sequences K9WJS5
gi|428312453|ref|YP_007123430.1| WP_015184160.1.75295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]