SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428312492|ref|YP_007123469.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428312492|ref|YP_007123469.1|
Domain Number 1 Region: 830-1138
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 2.62e-66
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0000178
Further Details:      
 
Domain Number 2 Region: 625-791
Classification Level Classification E-value
Superfamily GAF domain-like 4.36e-51
Family GAF domain 0.00063
Further Details:      
 
Domain Number 3 Region: 464-618
Classification Level Classification E-value
Superfamily GAF domain-like 2.18e-42
Family GAF domain 0.0012
Further Details:      
 
Domain Number 4 Region: 394-441
Classification Level Classification E-value
Superfamily HAMP domain-like 0.000000432
Family HAMP domain 0.005
Further Details:      
 
Domain Number 5 Region: 112-256
Classification Level Classification E-value
Superfamily Sensory domain-like 0.00000643
Family Sensory domain of two-component sensor kinase 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428312492|ref|YP_007123469.1|
Sequence length 1141
Comment methyl-accepting chemotaxis protein [Microcoleus sp. PCC 7113]
Sequence
MATQFDPDPKAYKQEFNGLGKESQKAVNQNSFNMYGNNQPDLQLVSPQSVLNAVEHQQLG
GFVTAANPAKSGGFQWRNLRLTQKATALAIALGTLPVLLTGVTAYQFANRSITEQITQSK
ISSVASMQDKVNRFMRDRYGDIQILANLPVLTNPSQRDTTPLGEKQSQLDRFIAAHKVYD
LISVVDLNGNVIVQTKGLEPIPNQREREYFQEVLKTNQPVISDAIIPKVSKNPERLTLHF
AAPVKDSATGKTIAVIRARMPVTALEEQLQTFGANGDEFLLIDSSTKNIFLAKDKNLETK
EPSAVFSEWDKRPATEKPNSLIVHHKPTNDRELIAYTKFGQVEGLPTLDWEAVIAIPTDI
AFASQRQLLLILSLGTGLTALLVSALAVYLAKLATRPVLAVSDAVEKLGQGELYTRVAVE
GQDELAELGSNINLMASRLETLLWAQAAETEQAGLFGDIAVSNARTEKDLEDVFEKGVQG
ALRILEADRVVIYRLHPDGRGYISAEAVVPVWPRALGAKIEDPCIGKELLEEYRQGRVVP
TNNVYEAGFHPDHLRLMDRLQIKANLVTPILKDGHLFGLLIAHHCSNLHIWQQSEINFLK
ELAIRVGLCLDRVSFLEQKEVETLRAQQLHEITSTIRDAFSPEDIYQTAIAGVREALQTD
RAVVYLFDDKWQGTIVAESVGMGWPKALGANITDPCFADKYVEKYLQGRVKAVEDIYEAG
LSNCYMGQLEPFKVRANLVAPLLAYNKLHGLLVTHQCSNTRAWQESEITFFKQVATQVGL
ALDRVDFLAQIEQSRHKAETLADVQRQQKETLQQQLLELLSDVEGAAQGDLTVRADVTTG
EIGTVADFFNAVIESLREIVTKVKTAAGQVNTSLGENEGAIRQLSEEALKQAEETTRTLD
SVQEMTLSIQQVAKNARQAAVVARTASTTAEAGGIAIDRSVRNIFTLRETVAETAKKVKR
LGESSQKISKVASLIDQIALQTNLLAINAGIEAARAGEEGQGFAVVAEEVGELAARSAAA
TREIEEIVHNIQKETTEVVEAMELGTSQVVEGTNLVEDAKQSLHKILDVSREIDDLVQSI
STATVTQAETSQAVTELMKEIALVSERTSNSTRKVSGSLKETVEIAQELQASVGAFKVDG
L
Download sequence
Identical sequences K9WIR3
WP_015184199.1.75295 gi|428312492|ref|YP_007123469.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]