SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428312685|ref|YP_007123662.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428312685|ref|YP_007123662.1|
Domain Number 1 Region: 83-379
Classification Level Classification E-value
Superfamily Pectin lyase-like 2.2e-41
Family Filamentous hemagglutinin FhaB, secretion domain 0.0065
Further Details:      
 
Domain Number 2 Region: 551-634
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000000000607
Family Filamentous hemagglutinin FhaB, secretion domain 0.064
Further Details:      
 
Domain Number 3 Region: 390-490
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000000628
Family Filamentous hemagglutinin FhaB, secretion domain 0.072
Further Details:      
 
Domain Number 4 Region: 708-755,785-812
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000000408
Family Filamentous hemagglutinin FhaB, secretion domain 0.054
Further Details:      
 
Weak hits

Sequence:  gi|428312685|ref|YP_007123662.1|
Domain Number - Region: 810-859,901-926
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000596
Family P22 tailspike protein 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428312685|ref|YP_007123662.1|
Sequence length 1153
Comment filamentous hemagglutinin family domain-containing protein [Microcoleus sp. PCC 7113]
Sequence
MSINSRAKNEENGSANLTDYLSIFILNRAIFLLINFLLGGAIASLGNPTLAQIIPDATLG
AEPSVVTPLDDLGLPIDEIDGGATRGTNLFHSFLAFNVEADRGAYFYSPAGIQNILARVT
GGNPSRILGLVGTFGDSTANLFLINPNGIIFGPNAQLDVESSFVATTANSLVFENGLAFS
ATAPQSPPLLTINVPLGLQYGGNARSIETQGSRLQVLEGKTLALVGGNLQLNRTLLEAPE
GRVELAGVSDSGTIGLEVNNSSLRLNVPEAIARTDVSVNGSVIRSLGDGGSITIYADNLT
IDRSSVRAGFDADFGFNGTQAGDITLDAIGEVNIGQGSIVANSVLPDSTGNSGNVNIKAT
FVSLTDNAQIGAITFGQGNAGKILIEAKDSVSLTGNTSIRSNVGSDAEGNGGDINIQTPL
LSLTDGADLSTSTFGQGDSGNITVQANESILLVNGRIYSAVREGSIGKGGKINIQTNSLS
LSEGSALDSSVEEGGIGSGGDINLSVGSLSLTDNSVLFADTAGQGNAGTITVRANDFISL
TSSKIYSNVDFGANGQAGNIDIQTGYLSLVDGSRISNSTFGTGNAGSIFVQANDSISLIG
DTSAIISGVAWEAQGNGGDIQLAAKSLWLTNGAQLFAATFGAGNSGNIAINISDTVNLSG
VGSTTGFSSGLLTNTEEGAGGQGGDIRVTTSTLRVSDGAVLSAVSRSSFKGGNINVDANT
LEVTNGGQLLTTAFSSGDAGNITVNTSDRVILAGNDSTFTARLAQFDQVDTDGSASGLFA
RTEGTGAAGNVIVNTPLLTVQDTAQVSASTSGGTGGSIAVTANRFEAINGGQLRTTTAGS
NQAGNITLRVHEDVTLAGSDSGLFANTERGSIGNGGSILISNPKTMVIREGASVAVDSQG
AGEGGNIQIQAGAITLNNNASISAETASNAGGGITLQVQDLLLMRHGSRISTTAGTAQAG
GDGGNIAIDAQFILAVPKENSDITANAFTGRGGNINITTQGIYGLQFRPLLTPLSDITAS
SEFGVNGTVQIITPDVDPSQGLVNLPIEPVNVEVAQGCQAAEQQGAVEFFDTGRGGLAPN
PYEPISSSDIWEDVPSATQGTELEARAVPVSAALATPPDQIVEAQGWRINQKGEVVLVAE
VPITGTQRRCRLR
Download sequence
Identical sequences K9WKB8
gi|428312685|ref|YP_007123662.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]