SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428312702|ref|YP_007123679.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428312702|ref|YP_007123679.1|
Domain Number 1 Region: 39-298,325-380
Classification Level Classification E-value
Superfamily Pectin lyase-like 4.71e-28
Family Filamentous hemagglutinin FhaB, secretion domain 0.007
Further Details:      
 
Domain Number 2 Region: 607-737
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000000000068
Family Filamentous hemagglutinin FhaB, secretion domain 0.068
Further Details:      
 
Domain Number 3 Region: 869-998
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000000000033
Family Filamentous hemagglutinin FhaB, secretion domain 0.06
Further Details:      
 
Domain Number 4 Region: 738-867
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000000132
Family Filamentous hemagglutinin FhaB, secretion domain 0.068
Further Details:      
 
Domain Number 5 Region: 349-391,426-604
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000251
Family Filamentous hemagglutinin FhaB, secretion domain 0.08
Further Details:      
 
Domain Number 6 Region: 935-1097
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000091
Family Filamentous hemagglutinin FhaB, secretion domain 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428312702|ref|YP_007123679.1|
Sequence length 1257
Comment filamentous hemagglutinin family domain-containing protein [Microcoleus sp. PCC 7113]
Sequence
MPEIRQALNRCSLRFASGRGWQRGLVGCLVVGWVYSFSGNRATAQITPDATLGVERSVVR
ANANIRGQTADLIEGGAARGANLFHSFQEFNVGDGQQVYFANPVGIENILTRVTGNTLSN
IRGTLGVDGGANLFLLNPNGMIFGPNAKLDIPGSFVASTAKSLVFENGVELSATNPQAPP
LLTISITPGVQYGSNQPGSKITNVGKLAVGHNLTLAADTLDLQGQLSAGGDLTLKATDTV
RVQDSVANPFIASAGGQLLVQGDRIVDIFALNHPTSVFSSGGDIVWRSANTIGGDARVRA
GRNFRIEQLDGSFGNLSSPKDPVFEVAGDFSLANYTGASLQILAGGSVNISGNVTINGFG
GAFNDSSVTLSDGTTVALNGTTRPTLDIRAGTTGFSSIPTPGTPTSADISIGSITMRAPD
GVVFLTNQYAPNTLLTGGAIAVGTIRTDDTFGGFVGNSGSVIIDSRRGLTVNNRIDSSSA
TGNAGDIRLITSDVISLVNSVVTSDTSGLGKGGDIDIKARQLLVSDGASIIVSTFGEGDG
GSLTVNATESVQVIGTSVNGQTRSGLLAQTVEDSTGNAGNVTINTPVLLILGGARVSAST
FSSGDGGNLTINATESVQVLGRTADDESPSGLFALASGDSTGKAGNLTINTPQLLVSGGG
WVSVSTFSSGNGGNLTVNATGSVQVVGRSANDESPSALFALASEDSTGKAGNLTINTPQL
LVTDGAEVSTNTFGSGDGGNLLVNATESVQLVGTSADGQSVSRLSVDTQGTGKGGNLTIT
TPVLLVSDGAQVSAGTLSRGDGGNLTVNASSLVQLIGRSADSQFASAIYAQAERDSTGKA
GDLTITTPVLLLSEGAEVSATTFGAGDGGNLLINASSLVQLIGRSVEGQASSRIVARSQR
NSTGKAGNLTITTPVLLVSEGAQISATTFGSGDGGDLTINASSRVQVSGRSADGEVPSGL
FAQAERDSTGKGGNLTINTGRLVVENGGQVSASGTGAGIAGNLDITADSIFLSNQGGLRA
TTAAVEGGNIRLKVADSLILRNNSEIVASATGTANGGNINVEAGSYIVGILKENSDIVAD
ADRGQGGRITAKAPGIFGFRKFIDRRTPESDFSANSAVGLDGSVELNTQDKLEDQLPTNF
VDGTQLIDRRCTPPKTGQERSSFTITGRGGLPPSPNDTLQGESIITNWVTLDSNVENKTP
PATSTPQNSAPKQLVEAQGWYFNPKGEVVLTASAPTITSPGKWLPEASCNAPSARGQ
Download sequence
Identical sequences K9WJA6
gi|428312702|ref|YP_007123679.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]