SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428314200|ref|YP_007125177.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428314200|ref|YP_007125177.1|
Domain Number 1 Region: 30-341
Classification Level Classification E-value
Superfamily Pectin lyase-like 9.1e-42
Family Filamentous hemagglutinin FhaB, secretion domain 0.0091
Further Details:      
 
Domain Number 2 Region: 326-451
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000000091
Family Filamentous hemagglutinin FhaB, secretion domain 0.051
Further Details:      
 
Domain Number 3 Region: 526-610,642-670
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000016
Family Filamentous hemagglutinin FhaB, secretion domain 0.072
Further Details:      
 
Domain Number 4 Region: 457-585
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000251
Family Filamentous hemagglutinin FhaB, secretion domain 0.084
Further Details:      
 
Weak hits

Sequence:  gi|428314200|ref|YP_007125177.1|
Domain Number - Region: 690-785
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00534
Family Filamentous hemagglutinin FhaB, secretion domain 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428314200|ref|YP_007125177.1|
Sequence length 923
Comment filamentous hemagglutinin family domain-containing protein [Microcoleus sp. PCC 7113]
Sequence
MGCFLRQSRHRALWITSSIGLCLVTTSSLAQSQIVPDITLPNNTVVTPNGNTSLIEGGTR
VGSNLFHSFQDFSVPTGSEAVFNNALDIQNIFSRVTGGNISNIDGTLRSQGIANLFLINP
KGIIFGANAQLNLGGSFIASTANSVKFSDSSEFSATNPQVPPLLTINVPIGLQFGSNPGS
ILNQSQGSNNAGLQVPPGQTLGLVGGDLSLNTGNLTAFQGRIELGSVASPGLVSLTPTAT
GLVLGYEGIQTFGNIELSGAAVNASGLGGGTIQLRGGQVSLTQGSRLVADTFGNFNGGGI
DIQANQFRMQEGAFVSTSTFGSGAAGNLTVRADTVELTGTTPFVTSQQLLTGTFNPLSLS
DGLYSLSVGSGKAGDMTIDASQLKVQNGANLFTPALLNGNGGNLTFRVSELAEFSHGTLV
FTGTAGTGNAGNINLTAKQLRLLDGSSLSTTPGPTSTGTGGSITVTANTVEMRGTPAGVA
VPGGLFTTALGKGDAGDIRVSTHQLVVADGTQISTSTAGAGRGGDLTVTADTVELSGISA
DGRFIGGLLSSTSLLTVPGQPGNSSAGNLTVTSRRLTVQNGAQISGATGSGGTAGTLNVN
ASESVDVSGFATGVAPSVEAVSFGIIGDGIVPSAIETNTRGAGKAGDLTIQTGRLTVRDG
AEIGVRSTATGLPGDLNVRADSILLDNQGRMSATSILGQGGDIDLQVKQDLVLRNGSQIS
TQAGTEDTGGGNGGNITIKAGVLALFEKSSINANAFQGAGGNIRITTQGIFVSPDSSITA
SSTLGVNGVVEINQLGADPSQGLVELPVEVVDVTGLVATGCSADSGSSFVVTGRGGLPED
PTQTLRGQTVWRDLRPPRRVGREDTQRKRRDLATTHPQSPLVEATGWVRNAKGEVELVAH
APDVTPQNPWSRPPDCQTFNSQR
Download sequence
Identical sequences K9WPN7
gi|428314200|ref|YP_007125177.1| WP_015185900.1.75295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]