SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428314368|ref|YP_007125345.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428314368|ref|YP_007125345.1|
Domain Number 1 Region: 46-384
Classification Level Classification E-value
Superfamily Pectin lyase-like 1.66e-40
Family Filamentous hemagglutinin FhaB, secretion domain 0.0086
Further Details:      
 
Domain Number 2 Region: 550-600,630-652
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000000179
Family Filamentous hemagglutinin FhaB, secretion domain 0.072
Further Details:      
 
Domain Number 3 Region: 404-536
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000122
Family iota-carrageenase 0.063
Further Details:      
 
Weak hits

Sequence:  gi|428314368|ref|YP_007125345.1|
Domain Number - Region: 655-834
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000753
Family Filamentous hemagglutinin FhaB, secretion domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428314368|ref|YP_007125345.1|
Sequence length 1078
Comment filamentous hemagglutinin family domain-containing protein [Microcoleus sp. PCC 7113]
Sequence
MFLQKIDIWANKCMTRQLFKLTCYLGLGGAITLSGCLVNVFSGNYALAQIAPDTTLGAES
SVSTPLDAQGLPIDRIDGGAIRGTNLFHSFLEFNVAANRGAYFFSPVNIQNILARVTGSN
ASQILGTLGTFGASNPNLFLINPNGIIFGENASLDVGGSFVATTATAIQFGNQGFFSASN
PEAPALLTVNPSAFFFNQINAGRIENGSIAPAGLDLTGAPLFGLRVPEGRSLLFIGGDIA
LDRGRVNALGGRVELAGVAGTGTVGLNIDGNNLSVSVPENITRADISISNKARVNVTADD
GGDIVISAHNLDILEGSFLSTGIGLNLGTANSQAGDITLDATSTVTISGSDVINIVNAGA
IGQGGNMIVRAKSLFLTDSAFLAAVMRGRGDTGRVFVEVTEAALLTQGSTIFNTVQRGIG
NGGDIIFIAGSASFLEGAQLVADNRNAEGNGGNITVQVRDHIFIDGVYSDGFASGIFAAV
TPGGRGNAGNITLTAGSLSLTNGGRLQSNTRGLGDAGNIIIDVRDHIVIDGIDSPLGSGT
PSGVYTTVGTDGVGKGGDIYVTAGSLTATNGGQLTANTFEQGDAGNVTIVVRGHVSFDGV
NTDIPNNPSSSGVFSAVGEIVEMGRRIPAVGQGGNIHITADSLSVTNGAQIGTIVTSGSQ
GDAGSVTVITRKTASFDGVNNEPSGIFTYVESGAIGNANDIDITTGVLSVSNGAQLSAIT
AGKGDAGDIRVRANTLNITQGGQFLTTTEGSSRAGDINLDILDSVVLAGANSGLLANTTE
GSSGNGGSIFINNSRDVLIQDGARIAVDSKGAGVGGNIEIQADTLTLQNQARLLAETASN
TGGNITLQLQDLLLLRNNSKISTTAGTDQAGGDGGNITIDAKFIVGVPKEDSDITANAFQ
GQGGNINITTQGIYGLQFRPRLTPLSDITASSEFGLDGEFQLDLLTNVDPSRGLAQLPTN
IVDASDQIDRRCTPAASTQEPNSFTITGRGGLPPSPNDPLQNESIITNWVSLDSDVETKT
APVSITPKSSTPKPLVEAQGWMLNHKGEVVLTAAALTATPQGEWFPEAECNAPSVQSQ
Download sequence
Identical sequences K9WQ65
gi|428314368|ref|YP_007125345.1| WP_015186066.1.75295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]