SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428314372|ref|YP_007125349.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428314372|ref|YP_007125349.1|
Domain Number 1 Region: 30-304
Classification Level Classification E-value
Superfamily Pectin lyase-like 1.04e-30
Family Filamentous hemagglutinin FhaB, secretion domain 0.0086
Further Details:      
 
Domain Number 2 Region: 844-968
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000000011
Family Filamentous hemagglutinin FhaB, secretion domain 0.022
Further Details:      
 
Domain Number 3 Region: 1049-1194
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000000722
Family iota-carrageenase 0.063
Further Details:      
 
Domain Number 4 Region: 692-829
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000000643
Family Filamentous hemagglutinin FhaB, secretion domain 0.044
Further Details:      
 
Domain Number 5 Region: 472-653
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000942
Family Filamentous hemagglutinin FhaB, secretion domain 0.058
Further Details:      
 
Weak hits

Sequence:  gi|428314372|ref|YP_007125349.1|
Domain Number - Region: 1194-1282
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000345
Family Filamentous hemagglutinin FhaB, secretion domain 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428314372|ref|YP_007125349.1|
Sequence length 1556
Comment filamentous hemagglutinin family domain-containing protein [Microcoleus sp. PCC 7113]
Sequence
MAKSWKGRGWWLSLAVWLTMGESITGFNNCTSAQMTPDTTLGTESSVVTPNVNIRGLPAD
RIDGGATRGTNLFHSFSNFNVGEGLRVYFSNPSGIENILTRVTGNNLSNILGTLGVDGGA
NLFLLNPNGIIFGQNAQLDIAGSFVASTANGITFDNGFVFSAKNPEAPPLLTINVPLGLQ
YGSNPSGATIANSGNLTVGQNLGLAADNLDLKGQLQAGGQLALYALNTLQVRDSTTKPFI
AKAGGQMVVQSNQTVDIFALNHAESGFFSGGDMVLRSANTVLGDARYWSGGSFRIEGLDG
TLQDLSSPNDPIIRSIGDVSFNNYIGTSLHILAGGSVTIPGIVAITAPETGTVGVDYLAE
EVPLSDGTLVPINGSVRPTLDVRAGVEPGAIGIPGLTGNSDYLFYSGFINFFGFIFPISE
DPVGTNVPTSADINIGGIVMLGQNAANGQILLTNQYRPNQLLPGGNIEVGAIVTTDDVSE
FANQLPANLLTALNFAGLLDDFSGDGGSVILDSRSQITINGASLSNFGLNFGLINTSSGT
GKAGDVTLLANEKVSLANTFILSDTSGAGTGGDITIKAPSVSFTDKTVVSSSTFGTGQGG
KLTVIAPNSVDVAESNLFAATTGDGKAGDLNIVTGKLTVRDKAAIATVSLGNGDAGDLKI
DTQQLMIKDGSITTSTLGGPSFGTPLGQGNGGELIINASDSVELVSTSADSLIDLTIPIP
GFAFSEIQAPIGLFSSSQSSGSAGDLSITTGRLTIRGGAMASTTTSFGGQGGNLTVKASE
RVELIGTSNNTTVPSALISDTYRSGKGGDITIITPHLLIKEGGAVSAATGNVLGENDPND
RGQGGNVTVVSSLVELYGASSNPLLRSGLVTSTVGFGNAGDMLINADRLIVGDGAVVLTA
ALRDGNSGNLTVNASESVEVVGTAPDKLPSGISTGTAGSGAARDLTINTKRLTVRDGGLI
SAGTVASGAGGNLMVNASEWVELVGTGSDGRPSGLSAGSGITGVSSIPLLQRFGVDPSQA
TGDSGDLKLTTGRLIVRDKAEVSTATLGPGLGGNIHLQANSIDLSNGAQLSAATSGSGRA
GTISVQGPDTIALNNSSISTSVNAGAVGEGGKIDLQTRSLSLNNGAQVSAATSGKGQAGN
ISVRDADTVSLTNSAISTAVNAGAVGEGGDIDIQTRSLSVRDQSRISASTSGDGKAGSIT
VTGNTLEAANGGQLLTSTASGQDAGNINLTLQDEVKLTGDGTGIFANTAPGSTGNGGSIF
LDTTTLLLRDGAGIVVGSQGAGEGGSITAQSNSTTLDNRAFISAKTASNTGGNITLGVQD
LLLLRRRSEISTTAGTALSGGDGGNITISAGFILGIPKENSDITANAFTGRGGNINITTQ
GIFGLQFRPRLTPLSDITASSEFGLNGSVQIITLGVDPNRGLAELPTDLVDATGLIDRRC
VPGAGTEQSSSFTITGRGGLPPNPHETLGEEGLLEDLGTPVGVSTGSRKGQPRRASASSS
SSPPPLVEAQGWVIAPDGTVILTAQAPTATPQHPWQTPASCQTLSPSSVAPTASPR
Download sequence
Identical sequences K9WP25
gi|428314372|ref|YP_007125349.1| WP_015186070.1.75295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]