SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|556590535|ref|YP_008759203.1| from Staphylococcus pasteuri SP1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|556590535|ref|YP_008759203.1|
Domain Number 1 Region: 19-61
Classification Level Classification E-value
Superfamily HMG-box 0.0000307
Family HMG-box 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|556590535|ref|YP_008759203.1|
Sequence length 168
Comment hypothetical protein STP1_0680 [Staphylococcus pasteuri SP1]
Sequence
MTNLSAKESFISGTIKGKLNKHDAKKWKNLSDDTKRELIELYKNDKYAFDYRLKNYLQDE
SKFVKENENHLSDESREHLIKFFATQGIYNPSETTLKAFSKQSILANFDKFYNLMGMFTL
NTEKQALYNYYMTQQKQNFIQIAQNDKLIKQNDEIIDLLNQIANKGEM
Download sequence
Identical sequences U5UNT1
gi|556590535|ref|YP_008759203.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]