SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Coclu2|110333|e_gw1.7.1297.1 from Cochliobolus lunatus m118 v2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Coclu2|110333|e_gw1.7.1297.1
Domain Number 1 Region: 20-275
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 9.42e-82
Family Rhamnogalacturonase B, RhgB, N-terminal domain 0.000000109
Further Details:      
 
Domain Number 2 Region: 366-530
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 7.65e-49
Family Rhamnogalacturonase B, RhgB, C-terminal domain 0.0000014
Further Details:      
 
Domain Number 3 Region: 278-359
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.000000000000628
Family Rhamnogalacturonase B, RhgB, middle domain 0.0000636
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Coclu2|110333|e_gw1.7.1297.1
Sequence length 531
Sequence
MFFKSAILAAATLSSTSLAAFGVTESGTNIVVDAGSTNPFVFSVNTKNCDINSIKYEGEE
LQSPSKGTQIEMGLGSADVKHEMVGNEYIRITCTTSTLIQYMVVRSGDSTIYMATDITAE
PTIGELRFIARLDSIKLPLSYPFGIVSTTANSSSTVEGSDVFVVDGQTRSKFYSSDRFID
DTVHCVYRDNNAIHACLLMNSYSYETSAGGPFHRDINTNNGGPSTSLTFYMNSNHVQLEK
YRMGMKGPYALSFSRTGVPKGGESMDTTFFKDLAIPNYVAPSGRGTVTGTATGVDSKFQT
VLHWYNDAAQYWAYADGSGKFSSPAMKPGTYTQVLYQGEFKVKATTVTVSAGKETAGNIA
ADTETKTSLWRIGEWDGQPKGFRNADKQLRMHPSDSRMASWGPLTYTVGSSTLDNVPMAI
IKGMNPFVIKFKGSSSATTLRVGTTLAFASCRPAVKINSFSAPVPAAPTKIDSRGFTRGA
YRGYGEVYNYAIPAGTLVDGENTINITCTSGQTGEGFLAPNVILDAIELFE
Download sequence
Identical sequences jgi|Coclu2|110333|e_gw1.7.1297.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]