SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Coclu2|40105|gm1.8855_g from Cochliobolus lunatus m118 v2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Coclu2|40105|gm1.8855_g
Domain Number 1 Region: 21-278
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 5.96e-48
Family Rhamnogalacturonase B, RhgB, N-terminal domain 0.00011
Further Details:      
 
Domain Number 2 Region: 371-544
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.04e-36
Family Rhamnogalacturonase B, RhgB, C-terminal domain 0.0000357
Further Details:      
 
Domain Number 3 Region: 276-361
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.00000000196
Family Rhamnogalacturonase B, RhgB, middle domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Coclu2|40105|gm1.8855_g
Sequence length 547
Sequence
MRCLSVLATFLLAPAAVFAAWGYTDDGKNYVIDTNANLVVKVSKTNADMTSIKYRGVEYN
GQNGKNSHVESGLAPGTVTIKQYTTPANIIKVTMKVGTLIHTLVFRYGNPNVYIFMNKKD
TSITVSRYILRIPANIFTNNPNEDTDWVPNNAPAIESGDINGVNGQTWSKHYSGKLYGRT
MDYDWVGYTNKNVGMYMIRSNHEKASGGPFFRSLVRRGGDGGPDLYDIYQYNMGHTDGMR
FGLQGPSVLHFTDNGAAPNHNLFARNANWDWFDGLEIEGWVPASRRGAVAGVGLANMKSG
FQYVVGLKSDQAQYWTTATGAWRISNVLPGSYTLTVYKGELEVHISTVDISAGSTTTRNT
ITCSDPSDVAAIWRIGEWDGTPKGFLNFGDTPMKPTYMHPSDSRLAKWDTGNYIIGTSTA
ANFPGYMWKDINNDHIVYFRLSDAQLAQGAKIRIGVTQGQAGGRPTIAVNSWVAKLPADK
GQGDTRSLTVGTYRGNNYVYEFDVPASAWVQSAREYQLLKISIISGKTATGYLSPGVSFD
AIDMIAA
Download sequence
Identical sequences jgi|Coclu2|40105|gm1.8855_g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]