SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|374983291|ref|YP_004958786.1| from Streptomyces bingchenggensis BCW-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374983291|ref|YP_004958786.1|
Domain Number 1 Region: 14-241
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.2e-23
Family Protein kinases, catalytic subunit 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|374983291|ref|YP_004958786.1|
Sequence length 360
Comment hypothetical protein SBI_00534 [Streptomyces bingchenggensis BCW-1]
Sequence
MTVGLTVVSGSGHTWRLTEQIGSGAEGFVYGVDDGRPLVAKLVPDPPDPEAYRRRVARLV
RQRREPRTVGLLSGTPVRLAWPLVPVRTGGGTGSDRVDGYVMTDMRHAYQPFSRLLTVST
RTAFLPRATWATALHAARALARLLGELHTEGYVVGDLKPDNLWVDETGRVGMADVDSWQF
TDGREVFPGRMRTPGYTAPERIGAPAGTPPDTASDEFALAVLVHQLLMAGLHPFAGHPAD
GGDYLSYDDNVAHGRCRIVDRTSVLLPRSVPPADLLPRRLAELFRTAFGPARRRPTAAEW
AQALAAELAPGRLKACAVNARHLHTVERPWCPWCDQAERGADSYPGGGADGHPGRPQEEA
Download sequence
Identical sequences D7C0G4
WP_014173134.1.69245 gi|374983291|ref|YP_004958786.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]