SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|374983648|ref|YP_004959143.1| from Streptomyces bingchenggensis BCW-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374983648|ref|YP_004959143.1|
Domain Number 1 Region: 25-278
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.66e-60
Family Protein kinases, catalytic subunit 0.0000841
Further Details:      
 
Domain Number 2 Region: 664-769
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.000000000000816
Family Quinoprotein alcohol dehydrogenase-like 0.0028
Further Details:      
 
Domain Number 3 Region: 415-465,522-652,685-745
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.00000000361
Family Quinoprotein alcohol dehydrogenase-like 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|374983648|ref|YP_004959143.1|
Sequence length 778
Comment Serine/threonine protein kinase-like protein [Streptomyces bingchenggensis BCW-1]
Sequence
MTVNVTADEPALPVRPLLGHDPESFGRYRLLARLGSGGMGTVFLARSDGGRTVALKAIHR
DLAEEREFRERFRQELQAARSLGGADFFPAVVDADTDGPRPWLASEYLLGPSLAQAVEAH
GPWPYAALRALGVALARGLATVHRQGLVHRDLKPSNVLITADGPKLIDFGLARAVGAERL
TRTGRQMGTPAYISPEQARPVGGQSAGPPADVFALGGLLVYAATGRAPFGEGGANDVLYR
VAYAEPDLAGVPEELWPLVVGCLAKDPADRPAADRIARALTGTGTGDDGERDRDLDLDRQ
WDGERQRDGERERFAGLLPAGVLHDIALRTATVWDVAVRRPEEPQAPASAATAPEAPPPQ
DAPRPARRRLVLGGLGALAAAGVAGGVWWAVAGSGDDDTRGEPRPGPGGSGTDTAPQPLW
EYRGPLGDLGTPLYHRGVIAVQADPGAGILGVDARRGTLRWTAPAVSGYTPMACGDLIVM
KATYADGDDRLAMVDPADGRTWYSDPLGVTFRFTDHPISAGDARTAYVTGHSGAHRDGTP
DSRRRYLLAYDMVARKVRWRRELERGSATHLPGVVAEGRLVLVDDGSVTAYDTADGRRRW
QVALPGDGLVAGDGSDMVPRWTATVARGTVLMTGSGLRTIDLRTGRGGRQLDPDQLPSGT
GDEAVFGVPALADGVAYLTVLGTHVFAIDLASHHVRWRWKADTDLASPPAGTAVAGGLVF
PPSSDSRAAAVAVDRRTGRTRWTLRDSSGSILGTTEPLVGQGRLYVVRGKSIRALPLT
Download sequence
Identical sequences D7C624
WP_014173491.1.69245 gi|374983648|ref|YP_004959143.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]