SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|374984350|ref|YP_004959845.1| from Streptomyces bingchenggensis BCW-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374984350|ref|YP_004959845.1|
Domain Number 1 Region: 905-1245
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.2e-84
Family WD40-repeat 0.0000504
Further Details:      
 
Domain Number 2 Region: 635-938
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.83e-69
Family WD40-repeat 0.0000483
Further Details:      
 
Domain Number 3 Region: 118-361
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000000392
Family G proteins 0.088
Further Details:      
 
Domain Number 4 Region: 15-76
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.0000828
Family SinR domain-like 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|374984350|ref|YP_004959845.1|
Sequence length 1279
Comment XRE family transcriptional regulator [Streptomyces bingchenggensis BCW-1]
Sequence
MPRRERPLESGDGLLLEFAAGLRQLRRKAGNPTYRRLAEQAHYSISTLSSAASGQRLPTL
TVTLAYVRACEGDVEEWEQRWREAAEQLGEAPSALGSGEESDADSPYSGLRSFREQDAEW
FFGREQLVDELAGRLERQRFVAVIGASGSGKSSLLRAGLVPRLEGAATTVVLTPGPRPLE
ECAVRLGALAGVTPGGLYEELKEDPENLGRAVRQITVRSDAAGGDVVLVVDQFEEAFTLC
RDDFERDRFIEALVTAASAEGARCRVVLGVRADFYTYCTHNAPLVEAMRDAQVPVGPMGL
DELRRAVVKPAHRAGLTVEGALLATLTAQAHAQPGMLPLLSHALLQTWRRRRGNALTLDA
FEAAGGLEGALVRTAEDFFRQLNGEQRKLARRVFVRLTALGEGTQDTRRPARLEELEGLA
EADGGDIDAVLHRAAAARLLTLDRERVELAHEALIRCWPRLRRWLTEDREDTRTLRRLTD
AAQVWEALGRDPGALYRGTRLTMATGLDRTSLSAPEREFLDASSAARAAEQAAVRRRTRL
GHLAVALLSTLLVLTTSTAVLAVVAQRTADRQRDDAGAQRDVASSQRAAEKAAAVRAANP
ALAAQVSLAAYRLSPTPEARGALLSTFATPYATQLTGRRIVVTTVAFAPDGSTLATGDAD
GTVRLWRVSDPHRPRELGALPRLAGPVRTVAVSPDGRLVAAGGEDGKVAVWDIGDVRRPR
LVARLAADAGPVVGLGFGPGKGTLAVVARDGIRLWRLSDGHRLRRLAALEVSAAVTAVAF
SRDGRKLATGHADHTVRLWAMPASGGRPRQLSAEAGPSGIVNAMAFAPDGRRLATGGSDY
KVRLWDVASPRDARPVKVLTGHTDAVTTVAFSPDGRTLSSGSTDATVRRWAVTADGPARE
LAVLSGHTSGVGALAFSPDGRTLVTGSADQTARLWDLPGPALTGHSSSVYSAAFSPDGRL
LATGSYDRNVRIWSLADMRGPRELPPLAGHTGPVNSVVFRPDGRVLASGSADGTVRLWAL
DASRRPRLLDVLPSRVGHVNTIAYSPDGHTLATGGEEGTVRLWDVTDVRRPRPLAALRRA
GAVDSVVFSHNGRTLAVGDRNRTASVWNLADRRHPGRLAVLVGHTDGVKSVAFSPDDRTL
ATGSEDRTVRLWDLADPRHPVLRSRLSGYADGVMSVAFAPGGQMLAAASSDDTVRLYDIA
GHGGAQELALLAGHNKPVDTLAFSPDGRTLATGGEDWTALLWDPSAERVASRICATAFPA
LTRAEWRQYFPQHTYRPPC
Download sequence
Identical sequences D7CFH8
WP_014174193.1.69245 WP_014174193.1.9551 gi|374984350|ref|YP_004959845.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]