SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|374984512|ref|YP_004960007.1| from Streptomyces bingchenggensis BCW-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374984512|ref|YP_004960007.1|
Domain Number 1 Region: 11-268
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.2e-65
Family Protein kinases, catalytic subunit 0.0000173
Further Details:      
 
Domain Number 2 Region: 360-707
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 4.37e-53
Family L-arabinose binding protein-like 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|374984512|ref|YP_004960007.1|
Sequence length 715
Comment putative serine/threonine protein kinase [Streptomyces bingchenggensis BCW-1]
Sequence
MIPLRSGDPVRIGGYRLLGRLGAGGMGIVYLARSTGGALVALKVIQAQYAHDPQFRARFR
REVTAARSINTPWATTVPDADTESDTPWLATTYIPGPTLTETITTHGPLPHTTTHTLATN
LAQALHTIHQTGLIHRDIKPANILLAPNGPRLIDFGIARAHDDTAITARDVVIGSPGYLS
PEQALGRGPELGPPSDIFSLGCVLAYATTGRPPFGTGPVAAMLFRTVHDTADLTGVPDGL
RPLVEACLDKDPGRRPTAAELVRLLAEVGPPADGTGWLPRPVAQLIAKRSAELLALPDVP
PTVVGPADEAPKPRPGRRRFLAVASGGAVLAAGGGLGIWAASLPDAGSGGGGRPTPPRWT
VGVHADLTEGQAAAGTAQRRGAELAVERLNARADRPVTLALKVLDDRGAPGGARGVAERM
AADPAVIAVIGPTADATCEAAIGTYDKAGLPLLSVSVGTAEVSAVEHPSYLQTRPDDGSL
GLPLLSYLALHTRPHRTALVDDRAAGDYSWNLVRSMATAMRGGDLPSVTVTVPANTRDFG
RAVDEVRRSGVRAVVFGGLAPRAALFARELASAGFTGARLATQPVIDAAFLKRAGAAANG
WLLSSAFIDATALPAARPFAAAYRKRYASALGRYAAEAYDVVGLIAQALRELGPQGADRE
AMARRLRAVRYRGITKTYAFERGNGSLTPGTGLFLYRVEKGRFRFLGDYESATRA
Download sequence
Identical sequences D7CH41
gi|374984512|ref|YP_004960007.1| WP_014174355.1.69245

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]