SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|374984540|ref|YP_004960035.1| from Streptomyces bingchenggensis BCW-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374984540|ref|YP_004960035.1|
Domain Number 1 Region: 192-209,242-483
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.00000000294
Family Quinoprotein alcohol dehydrogenase-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|374984540|ref|YP_004960035.1|
Sequence length 496
Comment hypothetical protein SBI_01783 [Streptomyces bingchenggensis BCW-1]
Sequence
MSISRAVKPIALPLAGVLMSCAVVFHWLGWSALSSESHGACGGRYDPCPEGLTPVLILAF
VFTFAGAFGVIIAVALNSGSLATPWMASLVVVGLAGGVWPGVLGYEWLRGPHLDVAWEAS
RDRPSSVRAVGDWMPGPSTLVRARNDGLFGYDTSDGTRRWTVPAPERRSVCTMSRTTPSA
IGLVGLGRYEKPCDTVLAVDLSSGRTLWTKKIKADDSVTGATDARLVGAGDTAVALEQKA
VVGLGLRDGAARWRSPLDRNCEALAVDATPERALVVEQCTNTDGENAKMRLSALDPRSGA
WQWHSTLPTESKWKTLFMLSADPIVVYVDEDDDRGTDAVISFDDKGRRQAVIPRSGPEDD
LDFQVMPYSYSQPSDARPVFRSVVTKGLFITAVGPTDKDAPEDVAAYSLKDGRRVWKTSL
GAAVAALTQDRAGELDLLAGGGVWRLDPATGEKRGRTPLRGAPVGDVLALHRVKSGRYVI
VNSNGAEDAPPVFAVK
Download sequence
Identical sequences D7CH69
gi|374984540|ref|YP_004960035.1| WP_014174383.1.69245 WP_014174383.1.9551

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]