SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|374985147|ref|YP_004960642.1| from Streptomyces bingchenggensis BCW-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374985147|ref|YP_004960642.1|
Domain Number 1 Region: 5-39
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.000000267
Family Protein kinases, catalytic subunit 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|374985147|ref|YP_004960642.1|
Sequence length 59
Comment hypothetical protein SBI_02390 [Streptomyces bingchenggensis BCW-1]
Sequence
MTDRDLLGGRYRLLRKIGLGGMGVVYEALDSTLDRRVAVAADWPICSRSPVTTSRRAKC
Download sequence
Identical sequences D7BWW6
gi|374985147|ref|YP_004960642.1| WP_014174989.1.69245

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]