SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|374985454|ref|YP_004960949.1| from Streptomyces bingchenggensis BCW-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374985454|ref|YP_004960949.1|
Domain Number 1 Region: 20-80
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 0.0000118
Family Transglutaminase, two C-terminal domains 0.0063
Further Details:      
 
Weak hits

Sequence:  gi|374985454|ref|YP_004960949.1|
Domain Number - Region: 243-312
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00791
Family Beta-D-xylosidase C-terminal domain-like 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|374985454|ref|YP_004960949.1|
Sequence length 314
Comment hypothetical protein SBI_02697 [Streptomyces bingchenggensis BCW-1]
Sequence
MTGRDETRFDTLGPTLTVTTVPADPAGGDAVTATAHLTNDCPFPLRDAVLHLIGPGATTA
AKTIPLGDLRRGAKITRSWQTAMPADVAGDVSFTAHLVFDVDGNSSDCARSARTVSIPYE
PNGVREPYTTFATTDDATFGQYAPGQLVIWAGGRDLSGGSDEKGVIYLPGAAAESCVVQV
RTAGLTGSDNPSAKSGIAIAGDLTAPGKGGYAVLTMSARYGLEFMTDSDGDGRLDTWAGG
GGSYHPAWLRLVRSGTTYTAYATGNGLAWERVGTATVPSASGAGDAGVVASAVNANYPGT
TVRAVFDHFSVEAP
Download sequence
Identical sequences D7C0U6
gi|374985454|ref|YP_004960949.1| WP_014175295.1.69245 WP_014175295.1.9551

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]