SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|374986144|ref|YP_004961639.1| from Streptomyces bingchenggensis BCW-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374986144|ref|YP_004961639.1|
Domain Number 1 Region: 12-261
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.5e-62
Family Protein kinases, catalytic subunit 0.000055
Further Details:      
 
Domain Number 2 Region: 386-599
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 6.28e-17
Family Quinoprotein alcohol dehydrogenase-like 0.0092
Further Details:      
 
Domain Number 3 Region: 568-710
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.00000000000863
Family Quinoprotein alcohol dehydrogenase-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|374986144|ref|YP_004961639.1|
Sequence length 719
Comment hypothetical protein SBI_03387 [Streptomyces bingchenggensis BCW-1]
Sequence
MNPLGPGDPLRLGPYRLVAVLGDGGMGRVYLGRDRTGRAAAIKVLRPELAYDQNMAQRFV
REAQVAQAVTSTGVARVLGAWHEGGWPWMATEFLAGPTLDQHIDEYGPFDDQGVRELGAA
LARALQDIHAAGLVHRDLKPSNIVMTASGPRIIDFGIARPEHGLTLTLTGQIPVTPGYGA
PEQVLGQRVGPPADVFSLGAVLAYAASGERAYDGGHAATVQYQVVHGEPNLSEVPEPIRA
LVAPCLAKDPAYRPLPEQIAAVFAPPSGTKPGAKKIWQLGELAADIKLREAAAKQLISLP
DVRTPSVPSRRRLLTALAAGGGTVLAAGGGGLAWWLLSKDTGAGEARKPTEEESTAPPKP
WDAKRLTASQYEDGTAPPSLWGPQDGPSPVVIQPLPVRDLVLVHEGGSTTLGAYNVMDGT
RKWGTAVGSYAHYVAPSEELVVTVGPMTVGSTGRLLALDSATGKKKWTAPANAVHVIAAD
TKSVYFTARRDPTSTDVSLLGAFDIASRTTRWTVPMPVECTLVTPPKAATDSGCLVLCGQ
NGKVATLDTRTGKQVWTLPRQAVAIVPIAPAVSEGIVYLGGKTLTARKLEDGEEIWSVPA
RSEFKKTYGGWGAPTLDGDALYALDGEEISCRDRRHGNADWTRSLGDVLQRLYPPVVQGK
TVWANVDIIDSGGIAVLYKDTGKPAWTYARDGRGEWGMAASGNRVFLVHSGKLAAMPVF
Download sequence
Identical sequences D7CAF1
WP_014175985.1.69245 WP_014175985.1.9551 gi|374986144|ref|YP_004961639.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]