SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|374986387|ref|YP_004961882.1| from Streptomyces bingchenggensis BCW-1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|374986387|ref|YP_004961882.1|
Domain Number - Region: 74-235
Classification Level Classification E-value
Superfamily UDP-Glycosyltransferase/glycogen phosphorylase 0.00022
Family UDP-N-acetylglucosamine 2-epimerase 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|374986387|ref|YP_004961882.1|
Sequence length 290
Comment hypothetical protein SBI_03630 [Streptomyces bingchenggensis BCW-1]
Sequence
MGPTVLPWREARRRRFDLAVACTAHRSMWNLGAPLMVLPHGAGYNRLIAESTGNTVSAVG
LSRRELTRFGRVIPRIIGVSHEEQIGRLARSCPAAVSRALLVGDPCFDRMERSLALRDEY
REALGVVGGRRLVVVNSTWSEHSLIGTCEDLPLRLVRALPTDEFAVAVVLHPNVWARHGT
ARVLGRLVSAMDAGLLVIPPEQGWQAMLVAADCVVGDHGSTTFYGAALDRATAVMGTGED
ELDPASPTAESNPLHQRNTTKTSPPSRSADFTPPSEDHQQHPESETEPNH
Download sequence
Identical sequences D7CE64
WP_014176225.1.69245 WP_014176225.1.9551 gi|374986387|ref|YP_004961882.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]