SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|374986450|ref|YP_004961945.1| from Streptomyces bingchenggensis BCW-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374986450|ref|YP_004961945.1|
Domain Number 1 Region: 797-898,966-1249
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 3.66e-34
Family Quinoprotein alcohol dehydrogenase-like 0.016
Further Details:      
 
Domain Number 2 Region: 621-885
Classification Level Classification E-value
Superfamily WD40 repeat-like 5.31e-20
Family WD40-repeat 0.0037
Further Details:      
 
Domain Number 3 Region: 115-326
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000397
Family ABC transporter ATPase domain-like 0.08
Further Details:      
 
Weak hits

Sequence:  gi|374986450|ref|YP_004961945.1|
Domain Number - Region: 17-78
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.00482
Family SinR domain-like 0.072
Further Details:      
 
Domain Number - Region: 359-443
Classification Level Classification E-value
Superfamily Ribosomal protein L16p/L10e 0.0217
Family Ribosomal protein L16p 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|374986450|ref|YP_004961945.1|
Sequence length 1293
Comment putative WD-40 repeat protein [Streptomyces bingchenggensis BCW-1]
Sequence
MGRKESPLDPSAGPVQRFAYELRKLRSEAGGPTYRAMAQRVPYSLTTLSRAAAGDQLPSL
PVTLAYVEACGGDPADRIAWEARWREAAEETTGLPAEDDDATPPYRGLARFEPGDHERFF
GREQLVTDLLELVRERRFAAVFGPSGSGKSSLLRAGLIPALRDDGTAAPLPRPSVIRVLT
PGDRPLRTHADALGPKLGPKGDEGDTWLVVDQFEEVFTLCQDPAERAGFIERLLSAQDED
SRLRVVIGVRADFFGRCAEHRELTAALRGATLLVGTMGRAELREAIVKPAAAEGLIVERA
LTARIVEEVVDEPGGLPLMSHALLETWRRRRSRALTVEAYEAAGGVHGAIALTAERVYGE
LSERQAEAARRIMLRLITPGEGAQDTRRPVDREELGLGSGSGSGDGADTALVLERLVRSR
LVTLDEGTVDLAHEALITAWPRLRGWIDEDRQRLRTHRKLTEAARNWEELGRDPGALYRG
ARLVEAREVFEEPDDSAELTPAERDFLAASRAAGTRERRRVRAFVGAVAVLVVLALVAGV
VAWQQNRAGEQRRAEAVSRRIASVAQNMRYADPVTAMRLSVAAWNVSHTLEARAALLGAM
GQRERDTFTVPGGSAFEQALLSADGRTLVTSGELNGRVVGWDLATHRRISSIKTSDETES
ATAVSPDGRRVVTFGEAGLRLRDRASGRPIGPPIEIEDGDADADFGASGRMLMVEDGHWL
RLWDIRNRRRLLFQRSSETMWEPTLSMDGGRIALCSDQDELEVWDVRAHRRIRTLPAVVS
RLGCGSAEDTDGAEFLLTPDGRRLLISTAKGVRGWELASGKELPGISHSGLGYLALSRDG
RLLAATDDQEILVWRLDSPGRPVYRHPLAGRRVSGLQLDADHGVIRYQEGDGTASDAVRT
LYLGSATTSEWGPKRDGEALFRPDGSLIAEVRTSGGRERIELRRTGGGAPVAAALPSADC
RTTGQPGHKGQYCLPLMAFSADGRTFAYGFGERDAANGRARAERVAVWDVHKGRKTADLV
LTPKGADESGGDSIALTEGEAGADSIALTPDGRTVLVYRHLSEALELWGVHSRTRVTRRA
PGLAESVDVGGSGDFWMAFPDSSALAVRPDGRMVITASGQRFTLPSGRPDQLTRSQDPVY
ALAYRPDGEQLALGTDSGQVTLWDGSAERRLGVVAGTLTGEGRESAEPVKALAYSPDGKI
LAVAGDKGTLRLWDTASGLPLGSVLLTAGDNIRALAFSEDGRTLLVAGEHVPLQKIAVDP
ARVTTAVCERAGGGLHRADWKTYIPEVPYRKVC
Download sequence
Identical sequences D7CEC7
gi|374986450|ref|YP_004961945.1| WP_014176288.1.69245

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]