SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|374986976|ref|YP_004962471.1| from Streptomyces bingchenggensis BCW-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374986976|ref|YP_004962471.1|
Domain Number 1 Region: 32-291
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.99e-63
Family Protein kinases, catalytic subunit 0.0000488
Further Details:      
 
Domain Number 2 Region: 534-604
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000454
Family Fibronectin type III 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|374986976|ref|YP_004962471.1|
Sequence length 610
Comment putative serine-threonine protein kinase [Streptomyces bingchenggensis BCW-1]
Sequence
MSGTNRDGSDERDDDVDAAIKPLAANDPARIGPHLLLGRLGAGGMGRVFLARSDSGRTVA
VKVVHEEHVSDEQFRARFRREIEAARRVGEQYTAPVLDAGPDDEPPWVATGYVPGLSLEQ
VVRRHGPLPAASLHALADGLLKALKDIHGAGIVHRDLKPSNVMLTMDGTKVIDFGIARAL
ETSVETLLTSTGMVVGSPGFMSPEQVRGQRAGVKSDVFTLGCVLTYAATAQLPFGKKAAN
QHAVMFEIVEGEPDLTGVEDASLRALIARCLAKDVTQRPEVDALLEDPERMRPPATRGAW
LPAGVVAHLARQSARLLDAEAAPLREESTDLATVGLRPKEDGPPEVVPAVSGAGAAKRER
EPRRRRTLIALPVVLVITVGGGTVALLQPFEGGGGGGTHAQSPGGSASAASGGSTSPSAP
SSSPSKGGKKKGSDDDGKKGKDEAEGTDQPNAQKSSRSSGASDGDGDSSSSSGDSGSDNG
GSGSSPGSDGKNSSAGGGGSSGSSGTSSGSPPPAMKSYRLDYTNSCVGACDMPLKVSWSA
ISRATRYDIHYTNKGSNYTEKNVNTVYSTGGTSYTIKGPFSGDKICVTVRAANTHGASAW
AETWCDTVPY
Download sequence
Identical sequences D7BS03
WP_014176811.1.69245 WP_014176811.1.9551 gi|374986976|ref|YP_004962471.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]