SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|374987387|ref|YP_004962882.1| from Streptomyces bingchenggensis BCW-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374987387|ref|YP_004962882.1|
Domain Number 1 Region: 953-1253
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.83e-102
Family WD40-repeat 0.0000153
Further Details:      
 
Domain Number 2 Region: 597-983
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 9.81e-102
Family Quinoprotein alcohol dehydrogenase-like 0.011
Further Details:      
 
Domain Number 3 Region: 100-309
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000772
Family G proteins 0.074
Further Details:      
 
Weak hits

Sequence:  gi|374987387|ref|YP_004962882.1|
Domain Number - Region: 2-62
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.0075
Family Probable transcriptional regulator VC1968, N-terminal domain 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|374987387|ref|YP_004962882.1|
Sequence length 1294
Comment putative WD-40 repeat protein [Streptomyces bingchenggensis BCW-1]
Sequence
MQRFAFELRKLRQEAGAPTYRAMAVNTGYGVTTLSRAAAGEQLPTLPVVLAYVKACGGDS
EEWEERWRRAAADEAAEPRADDDAEPPYRGLARFEPDDAALFFGRDQLIDDLLRLTAHHR
ITAVVGASGSGKSSLLRAGLIPRLRTTEGPDMRPAALRVITPGAHPLRDHEQRLVPKEGG
EGDTWLVVDQMEELYTLCTDPAERTAFIDRLLTAAAPESRLRVLIAVRADFFGHLAGHRP
LADALREATLLVPPMNRGELREAVVKPAQAAGLIVERTLTAHILDEVDGEPGALPLMSHA
LLETWPRRKGRALTLTAYEAAGGVHGAIAQTAEDLYTHLTPDQASCARRILLRLITPGDG
AQDTRRPAPREELETDTSPATAEVLERLVKARLVILDGHTVHLAHEALIAAWPRLRKWID
EDRDRLRLHRQLTDAAHAWQALGRAPGALYRGTRLATAEETFPIAGSGSDLTPLESDFLT
SSSTVRHREEAAAARTTRRLRQFATTVSVLLVLALTAGLIAWQQYRTSEQQRHQALTAQR
IALSRQLAAQSAGLMDSNPDLASLLAVEAYRTSPTKEASADLFAAAALPLNRRLTGHTDA
VGSVKFSPDGRTLASIGEGGKVRLWDVATGRRRTIVTGHSDDVADSVAFSPDGRTLATGG
ADTKVHLWNVVTGKLRATLTGHSDFVRSVAFSPDGRTVASGSDDKTVRLGNVATGELRTT
LTGHNFVDSVAFSPDGRTLAGGGEGKIRLWEVATGELRATLTGHSDFVGSVAFSPDGRTL
AGGGERKIRLWDVATGKQRITLTGHTEPVDSVAFSPDGRTLASGSQDTTVRLWNVATGEL
RTTLTGHSDFVNSVAFSPDGRTLASGSSDKTVRLWKVAISRLRTTLTGHTEPVDSVAFSP
DGRTLASGSNDKTVRLWNVATGKPRTALTGHAEVQGSVAFSPDGHTLASGGEGKIQLWNV
TTGKLRTTLTGHYDGAISVAFSPDGRTLASGSNDEHVRLGDVATGEVRTTLTGHYDGAIS
VALSRDARTLASGGAEGKIWLWDVATGEPRTTLTGHTDAVGSVAFSPDGRTLASGSEDTT
VRLWDVATGKLRTTRTGQTDMVSSEAFSPDGRTLASGGNDKHVRLWDVATGKLRTTLTGQ
TDMVSSVAFSPDGRTLASGGNDKHVRLWDVATGKLRTTLTGHTDAVWSVAFSPDGRTLAS
GGAEGKIWLWDVATGELRATLTGHTNAVGSVAFSPDGRTLASGSDDRTVRLWDGDLPDPA
SSIRKICQAVHRSFTSSERSVYLADQPSDPVCRS
Download sequence
Identical sequences D7BXH8
WP_014177221.1.69245 gi|374987387|ref|YP_004962882.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]