SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|374987937|ref|YP_004963432.1| from Streptomyces bingchenggensis BCW-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374987937|ref|YP_004963432.1|
Domain Number 1 Region: 16-102
Classification Level Classification E-value
Superfamily SMAD/FHA domain 8.8e-18
Family FHA domain 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|374987937|ref|YP_004963432.1|
Sequence length 111
Comment hypothetical protein SBI_05181 [Streptomyces bingchenggensis BCW-1]
Sequence
MLLICSDPCLELSHGPGAPLTLGRHPDWAPDTAAVFADRPKVSRRHVSITVEPDGRAWAE
EPPEGSHNGTFINGAKLMPGVRTPLRDDDQLRLGLRISITVRLYGPGTGAS
Download sequence
Identical sequences D7C575
gi|374987937|ref|YP_004963432.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]