SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|374987952|ref|YP_004963447.1| from Streptomyces bingchenggensis BCW-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374987952|ref|YP_004963447.1|
Domain Number 1 Region: 559-852
Classification Level Classification E-value
Superfamily WD40 repeat-like 3.21e-91
Family WD40-repeat 0.0000177
Further Details:      
 
Domain Number 2 Region: 775-1064
Classification Level Classification E-value
Superfamily WD40 repeat-like 8.24e-67
Family WD40-repeat 0.00013
Further Details:      
 
Domain Number 3 Region: 1041-1149
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.2e-32
Family WD40-repeat 0.00051
Further Details:      
 
Domain Number 4 Region: 74-282
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000011
Family G proteins 0.099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|374987952|ref|YP_004963447.1|
Sequence length 1189
Comment putative WD-40 repeat protein [Streptomyces bingchenggensis BCW-1]
Sequence
MARRTEYSTATLAQAASGDRLPSLPVALAYVTACGGDRAEWERRWQQVADQLLAEPPEDD
DAVPPYPGLRRFQPEDRERFFGRDRLTEELVGLVRARRFAAVVGASGSGKSSLLRAGLIP
ALRAGDEGTARGRPTALRILTPGPHPAQSHAHLLAPAGGEGDTVVVVDQFEETFTLCHDP
AERAEFIGLLLAALDPGRRLRVVVAVRADFFGHCAGHRALADALRDATLLVAPMTPEELR
EAIVRPAAAEGLIVERALTARLVAEVADEPGGLPLLSHVLLETWRRRRGRALTMAAYEAT
GGIHGAVAQTAEDLYTRLPSDQAQAARRILLRLVTPGEGAPDTRRPADRAELRADGPGEA
ATVLERLARARLITLDDEVAGLAHEALITAWPRLRDWIDDDRRLLRVHRQLTEAATGWER
LGRDPGALYRGVRLAEADEAFGPPERAADLIPVEEAFLTESRAGLRKERRRLRQVLTAVS
VALCLALVAAGVAFWQRNTAIDAQDRAVTAQQVAQSRQLAAQSAALLDSDPDVASLLAVQ
AYRTRSTKESTNSLYAAAALPLRKRLSGHADVVRSVAFSPDGRTLATGGADGAVRLWEAT
TGESRSTLTRRAGQVDALAFSPDGRTLATGGADGRVRLWEAATGEPRDTLAGHTGRVEAL
AFGPDGRTLASGSSFDDTVRLWDVSAGRPRTTLTGEAGNIRSLAFSPDGRTLAGGSSDGP
VRLWDAATGRTRDTLTGHTRVVGLVAFSADGRTLATSSYDGTARLWDVAKGTTRRTFGDH
TGRVWAGALSPDGRTLATSDGRQTVRLWDTSTGRVRTTLTGHTDYVLSIAFSPDGRALAT
GGLDRTVRLWDLARGQTRLTFGGHTDGVWAASLSPDGRTLATTDRGGPARLWDTRTGESR
TVPVSGDPGEAESVAFAPDGRTLAIGTSDGRVQFHDLRSGEIIERYADHIRHNVDVLAFS
PDGRLLAVGSDEAEDVQVWDTASGRVRTTLAASRLGVNALAFSPDSRTLAISGIRTADRV
QLWDLKRGRPRITLDTSRTGAVAFSPDGRTLATGGSDGTARLWNTADGGRRAALTGHIDA
ATSVAFSPDGRSLAVGSYEGGVRVWDVAGSRMRVALTGHTGAVKAVAFSRDGRALATGSL
DGTARLWNVFLPGPQEAISGICGAVHRDLTRRERSSYLPDEPSGRVCPV
Download sequence
Identical sequences D7C6S9
WP_014177783.1.69245 gi|374987952|ref|YP_004963447.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]