SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|374988215|ref|YP_004963710.1| from Streptomyces bingchenggensis BCW-1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|374988215|ref|YP_004963710.1|
Domain Number - Region: 2-48
Classification Level Classification E-value
Superfamily RING/U-box 0.03
Family RING finger domain, C3HC4 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|374988215|ref|YP_004963710.1|
Sequence length 61
Comment hypothetical protein SBI_05459 [Streptomyces bingchenggensis BCW-1]
Sequence
MTQCCYRCDKPTREPITVLRAAASGPGCLRHLCPDCNRRWPHPDADLYTVLVTLQRERQT
T
Download sequence
Identical sequences D7CAL2
WP_014178043.1.69245 WP_014178043.1.9551 gi|374988215|ref|YP_004963710.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]