SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|374988271|ref|YP_004963766.1| from Streptomyces bingchenggensis BCW-1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|374988271|ref|YP_004963766.1|
Domain Number - Region: 78-166
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.00106
Family Quinoprotein alcohol dehydrogenase-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|374988271|ref|YP_004963766.1|
Sequence length 197
Comment hypothetical protein SBI_05515 [Streptomyces bingchenggensis BCW-1]
Sequence
MREVVIALAAAALVASCTAGPTGGGGSPAATGSPTRKALDFSGDPRAAAPLTFDSKAAHV
LPTGPTDDPTIALYGRAAWLAHASGRAGLTSRMDCDQGEGGTVVLCASKQDGVLAVDKAG
KILWRRAAGDGPNDWSATVEADFKDLFYAKGKDGTFVVDGRTGRTVSADAGIVPDRINGY
AALVYADTGAEVHYAKR
Download sequence
Identical sequences D7CAR8
gi|374988271|ref|YP_004963766.1| WP_014178099.1.69245 WP_014178099.1.9551

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]