SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|374988745|ref|YP_004964240.1| from Streptomyces bingchenggensis BCW-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374988745|ref|YP_004964240.1|
Domain Number 1 Region: 16-271
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.43e-63
Family Protein kinases, catalytic subunit 0.0000267
Further Details:      
 
Domain Number 2 Region: 480-756
Classification Level Classification E-value
Superfamily YVTN repeat-like/Quinoprotein amine dehydrogenase 3.92e-20
Family YVTN repeat 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|374988745|ref|YP_004964240.1|
Sequence length 799
Comment serine/threonine protein kinase [Streptomyces bingchenggensis BCW-1]
Sequence
MRRAGTGPEAEDPEYAGQYRLEARLGSGGMGVVHLARSASGRRLAVKVVHAEFAEDPEFR
ARFRQEVAAARRVSGAFTAPVVDADPGGERPWMATLYIPGPTLAEHVKRNGPLPTEDMVR
LAAGLAEALRDIHRAGVVHRDLKPSNVLLAADGPKVIDFGISRPSDSELRTETGKLIGTP
PFMAPEQFQRPRHVGPAADVFALGSVLVHAATGRGPFESESPYIVAYQVVHDEADLAGVP
RELLPLVQRCLAKDPAERPTPDALMTVLRAIGGPHPPALRGPLPRVPAQRGRGTGPLWGD
DDGGSVTDAEIGTDTGTDTGTDTGTDTGTDAEAGTEVPAGDGSVDAVPDGSAPDDAAAST
SRDADTRVRAGSTDSADSAHAATAGQRRHKTAQRRWITVGVLAAVMLGAGTVWALQRDND
GQRSAHQQPGGTTKGAAWRPWKGTLPTDGSGGAQGEGARAAFCSYGGGALYCAGRGIDAA
RLDPADGKVLWWQPAEANRADDGTPTAPALSGGLVQVVSPDGARLRAFDPKTGHPRWSRD
VASYEGSVYPSGDTVLLVAADGVVTAVNGATNKERWSHTVPGHARPAFVSYGDGRTAYAL
TTSADGSHTLVTAVDTARGTALWQRSFRGNLTPAGADSAGVLYLTGTDDQTRTATVVRYD
PAHRAERRVALATPVSATSVAVRGGLVYLLCADGGLVAVDPRRTDPAAAQRWRMETSVGN
ASPLVAAGDRLYFSAADGRLLAVDAVGGELLGQTPPRTGKAQKSYLELVPAPVAADGKVY
GSAPDGTVFGVSGRDPARW
Download sequence
Identical sequences D7CHQ9
gi|374988745|ref|YP_004964240.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]