SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|374988928|ref|YP_004964423.1| from Streptomyces bingchenggensis BCW-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374988928|ref|YP_004964423.1|
Domain Number 1 Region: 6-265
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.8e-72
Family Protein kinases, catalytic subunit 0.00000316
Further Details:      
 
Domain Number 2 Region: 382-699,736-769
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 1.67e-33
Family Quinoprotein alcohol dehydrogenase-like 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|374988928|ref|YP_004964423.1|
Sequence length 771
Comment Ser/Thr protein kinase, partial [Streptomyces bingchenggensis BCW-1]
Sequence
MVARVLVGRYELVRFVGRGGMGEVWEGRDRVIGRRVAVKLLPHDRGDTTSADLFRREANT
AGALNHPAVVTVHDFGEDEAEGSLFLVMELLEGRNLATVLREDGPPPVATAVDWVAQAAA
GLTRAHEADVIHRDLKPANLHLAADGRVKILDFGIARFMEALPSSKVMGTFPYMPPERFD
GHSGEARSDLYSLGCVLHELLTGKLPFDATSAASMMSAHLTKTPVPPGRIRPGVPAALDE
LVMELLAKAPEDRPASAAQVHDRLRALSSPAASASSAASGPSLHDMATRTADAGDARDIT
PAGPASPATADAATATAGLPPTRVAWPTPRRAGFVTRRRALWLGAAAIAAGAGIPTGFAL
LDDGASSDDGKSPDHGTSASGAWFAAGGQKLSPPVVDGKVVYIKGQDLQDATVYALDGAT
GKKKWSYRLKDGGYGQAGANEGDSLNVPTPAVIGGAVYVMGTDDKLCVLDAVTGKKKWDY
APGGSVTWLTAVGGMVQVYVSDDEAIHSLDAATGTEKWATRRGIIGVKDYLVAGDGAVHV
YIDGKGDLRALDAATGSKKWELTGRWADRLWTAGGLVYTRTVVEPITMYALDAATGARKW
EFVSPTNQFAGGSSSAHKGTEVVGGVAYVVGTSAKDFDERTVHALDSATGKQKWSERLGD
DLGFGTLTAIDRALYVRGRDQTYALNVASGKTEWSITSPERQKLVGAGKVVYVSETADNP
HVQALHEATGTKKWGSAISGNSLRIGDGVLYVVSKNKEAVYALDTATGARI
Download sequence
Identical sequences D7BQS5
WP_014178752.1.69245 WP_014178752.1.9551 gi|374988928|ref|YP_004964423.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]