SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|374989060|ref|YP_004964555.1| from Streptomyces bingchenggensis BCW-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374989060|ref|YP_004964555.1|
Domain Number 1 Region: 12-272
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.72e-62
Family Protein kinases, catalytic subunit 0.0000415
Further Details:      
 
Domain Number 2 Region: 596-803
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 5.49e-34
Family Quinoprotein alcohol dehydrogenase-like 0.0056
Further Details:      
 
Domain Number 3 Region: 812-915
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 5.69e-21
Family Quinoprotein alcohol dehydrogenase-like 0.0041
Further Details:      
 
Weak hits

Sequence:  gi|374989060|ref|YP_004964555.1|
Domain Number - Region: 534-591
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.0018
Family Quinoprotein alcohol dehydrogenase-like 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|374989060|ref|YP_004964555.1|
Sequence length 926
Comment serine/threonine protein kinase [Streptomyces bingchenggensis BCW-1]
Sequence
MVEQLTQHDPRRIGPFEVLGRLGAGGMGLVYLARSASGRRVAIKTVRTELAEDQLFRVRF
TREVEAARAVSGFYTAAVVDADPRAAVPWLATAYVPAPSLEEIVNECGPMPAQAVRWLAA
GVAEALQSIHGAGLVHRDLKPSNVLVVEDGPRVIDFGIASGVSNTRLTMTNVAVGTPAYM
SPEQARDSRSVTGASDIFSLGSTLTFAATGHAPFHGANPVETVFMLLREGPDLTGLPDEL
RPLIESCMQMEPERRPTPADLQSQLAPHLFASNAEDSGTASAWLPAGAVALIERKRNGRN
QIARPARGADGRHGGDGASGGGASRPSAPLPPERPPTPTPGYDSAHGPGAGRGRHSAPAG
ASGWEPMPAGDPRGGLRTDMGNPVHPPHPPGPMSAIGPGRHAAPAAAGPSGSQAAPPSVQ
GPTGPGGPTGPGGPTGPGVAAGPTGPTGRPTGATGPAPIGADASVRLPGSKVPIGPGRRA
TDGREPQPQHETGPATGWVRPPSGLTGGGNGGEGGIAPGALPPPSSPPTSAPSPDASEAP
GGGAAHGRWRPWRFRMSNDVWGTPAVAGELLYVTSFEVHALDVATGRRQFKTRDVAWAMA
VSNGRIHASDGPTLYALDAEDGAERWRLSTDGWVYSLKVDRGTVVTGTRGGGVQAWEAAN
GELLWEMQGAQTDFETPESGPAIYDGTVFVWADARLRALEARTGVERWSYPIGDAASCGG
VPVRLLSAPDGCVYVAAGTRVLAIDIERGEVRWRFEAPAVFLCAPAYAPGPAVTGGGVYI
ADYLGTVYALDAANGRDRWRIATEARKSIEPVLVADGSVHLGSGSALYTLDAVTGTPKWR
FAAGGEVIGSPVVADGRVHFGSADHCLYTVDAAGGQLRWKLATGGEITGSPVAAGGVVYA
CSKDRCVYALDAVKGTGQSRASARQG
Download sequence
Identical sequences D7BSA6
WP_014178875.1.69245 WP_014178875.1.9551 gi|374989060|ref|YP_004964555.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]