SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|374989160|ref|YP_004964655.1| from Streptomyces bingchenggensis BCW-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374989160|ref|YP_004964655.1|
Domain Number 1 Region: 11-64
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.00000000000122
Family Protein kinases, catalytic subunit 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|374989160|ref|YP_004964655.1|
Sequence length 78
Comment serine/threonine protein kinase [Streptomyces bingchenggensis BCW-1]
Sequence
MDDLLPADPDRIGPYILEGRLGAGGMGQVYLGRSPGGRHVAVKVIRPEHATNPQFRRRFT
REVEGRTARRRIPHRTGH
Download sequence
Identical sequences D7BTV5
gi|374989160|ref|YP_004964655.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]